'V(L6`6\0(NetBSD/earm ramdisk 08 ՛`<   ՛`Fdt t ՛`@@<@T 08 ՛`<   ՛`Fdt t ՛`@@<@TU ՛`t`A ՛` ՛` ՛`A ՛` ՛` ՛`A. ՛` ՛` ՛`@HPA ՛` ՛` ՛`oA ՛` ՛` ՛`WA ՛` ՛` ՛`A ՛` ՛` ՛`A ՛` ՛` ՛`A ՛` ՛` ՛`A ՛` ՛` ՛`C ՛` ՛` ՛`A ՛` ՛` ՛`A ՛` ՛` ՛`$ ՛` ՛` ՛`mC! ՛` ՛` ՛` (08@HPX`hpx$ ՛` ՛` ՛`(08@HPX`hG$ ՛` ՛` ՛`pxG$~ ՛` ՛` ՛`@$ ՛` ՛` ՛` (08E! ՛` ՛` ՛` a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛` a ՛` ՛` ՛` a ՛` ՛` ՛` a ՛` ՛` ՛` a ՛` ՛` ՛` a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛` a ՛` ՛` ՛` a ՛` ՛` ՛` a ՛` ՛` ՛` a ՛` ՛` ՛` a ՛` ՛` ՛`a ՛` ՛` ՛` a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`! ՛` ՛` ՛`4! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛` ! ՛` ՛` ՛` ! ՛` ՛` ՛` ! ՛` ՛` ՛` ! ՛` ՛` ՛` ! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛` B! ՛` ՛` ՛` B! ՛` ՛` ՛`! ՛` ՛` ՛`"! ՛` ՛` ՛`"! ՛` ՛` ՛`"a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛` a ՛` ՛` ՛` a ՛` ՛` ՛` a ՛` ՛` ՛` a ՛` ՛` ՛` a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛` a ՛` ՛` ՛` a ՛` ՛` ՛` a ՛` ՛` ՛` a ՛` ՛` ՛` a ՛` ՛` ՛`a ՛` ՛` ՛` a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛` ! ՛` ՛` ՛` ! ՛` ՛` ՛` ! ՛` ՛` ՛` ! ՛` ՛` ՛` ! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛` ! ՛` ՛` ՛` ! ՛` ՛` ՛` ! ՛` ՛` ՛` ! ՛` ՛` ՛` ! ՛` ՛` ՛`! ՛` ՛` ՛` ! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛` ! ՛` ՛` ՛` ! ՛` ՛` ՛` ! ՛` ՛` ՛` ! ՛` ՛` ՛` ! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛` ! ՛` ՛` ՛` ! ՛` ՛` ՛` ! ՛` ՛` ՛` ! ՛` ՛` ՛` ! ՛` ՛` ՛`! ՛` ՛` ՛` ! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛` ! ՛` ՛` ՛`! ՛` ՛` ՛` ! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`?\! ՛` ՛` ՛`>\! ՛` ՛` ՛`=\! ՛` ՛` ՛`<\! ՛` ՛` ՛`;\! ՛` ՛` ՛`:\! ՛` ՛` ՛`9\! ՛` ՛` ՛`8\! ՛` ՛` ՛`?\! ՛` ՛` ՛`>\! ՛` ՛` ՛`=\! ՛` ՛` ՛`<\! ՛` ՛` ՛`;\! ՛` ՛` ՛`:\! ՛` ՛` ՛`9\! ՛` ՛` ՛`8\! ՛` ՛` ՛`:\! ՛` ՛` ՛`7\! ՛` ՛` ՛`6\! ՛` ՛` ՛`5\! ՛` ՛` ՛`4\! ՛` ՛` ՛`3\! ՛` ՛` ՛`2\! ՛` ՛` ՛`1\! ՛` ՛` ՛`0\! ՛` ՛` ՛`7\! ՛` ՛` ՛`6\! ՛` ՛` ՛`5\! ՛` ՛` ՛`4\! ՛` ՛` ՛`3\! ՛` ՛` ՛`2\! ՛` ՛` ՛`1\! ՛` ՛` ՛`0\! ՛` ՛` ՛`2\! ՛` ՛` ՛`/\! ՛` ՛` ՛`.\! ՛` ՛` ՛`-\! ՛` ՛` ՛`,\! ՛` ՛` ՛`+\! ՛` ՛` ՛`*\! ՛` ՛` ՛`)\! ՛` ՛` ՛`(\! ՛` ՛` ՛`/\! ՛` ՛` ՛`.\! ՛` ՛` ՛`-\! ՛` ՛` ՛`,\! ՛` ՛` ՛`+\! ՛` ՛` ՛`*\! ՛` ՛` ՛`)\! ՛` ՛` ՛`(\! ՛` ՛` ՛`*\! ՛` ՛` ՛`'\! ՛` ՛` ՛`&\! ՛` ՛` ՛`%\! ՛` ՛` ՛`$\! ՛` ՛` ՛`#\! ՛` ՛` ՛`"\! ՛` ՛` ՛`!\! ՛` ՛` ՛` \! ՛` ՛` ՛`'\! ՛` ՛` ՛`&\! ՛` ՛` ՛`%\! ՛` ՛` ՛`$\! ՛` ՛` ՛`#\! ՛` ՛` ՛`"\! ՛` ՛` ՛`!\! ՛` ՛` ՛` \! ՛` ՛` ՛`"\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛` \! ՛` ՛` ՛` \! ՛` ՛` ՛` \! ՛` ՛` ՛` \! ՛` ՛` ՛` \! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛` \! ՛` ՛` ՛` \! ՛` ՛` ՛` \! ՛` ՛` ՛` \! ՛` ՛` ՛` \! ՛` ՛` ՛`\! ՛` ՛` ՛` \! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`\! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛` ! ՛` ՛` ՛` ! ՛` ՛` ՛` ! ՛` ՛` ՛` ! ՛` ՛` ՛` ! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛` ! ՛` ՛` ՛` ! ՛` ՛` ՛` ! ՛` ՛` ՛` ! ՛` ՛` ՛` ! ՛` ՛` ՛`! ՛` ՛` ՛` ! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛` ! ՛` ՛` ՛`! ՛` ՛` ՛` ! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`$! ՛` ՛` ՛`4! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛` ! ՛` ՛` ՛` ! ՛` ՛` ՛` ! ՛` ՛` ՛` ! ՛` ՛` ՛` ! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`a ՛` ՛` ՛` a ՛` ՛` ՛`a ՛` ՛` ՛` a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`?\a ՛` ՛` ՛`>\a ՛` ՛` ՛`=\a ՛` ՛` ՛`<\a ՛` ՛` ՛`;\a ՛` ՛` ՛`:\a ՛` ՛` ՛`9\a ՛` ՛` ՛`8\a ՛` ՛` ՛`?\a ՛` ՛` ՛`>\a ՛` ՛` ՛`=\a ՛` ՛` ՛`<\a ՛` ՛` ՛`;\a ՛` ՛` ՛`:\a ՛` ՛` ՛`9\a ՛` ՛` ՛`8\a ՛` ՛` ՛`:\a ՛` ՛` ՛`7\a ՛` ՛` ՛`6\a ՛` ՛` ՛`5\a ՛` ՛` ՛`4\a ՛` ՛` ՛`3\a ՛` ՛` ՛`2\a ՛` ՛` ՛`1\a ՛` ՛` ՛`0\a ՛` ՛` ՛`7\a ՛` ՛` ՛`6\a ՛` ՛` ՛`5\a ՛` ՛` ՛`4\a ՛` ՛` ՛`3\a ՛` ՛` ՛`2\a ՛` ՛` ՛`1\a ՛` ՛` ՛`0\a ՛` ՛` ՛`2\a ՛` ՛` ՛`/\a ՛` ՛` ՛`.\a ՛` ՛` ՛`-\a ՛` ՛` ՛`,\a ՛` ՛` ՛`+\a ՛` ՛` ՛`*\a ՛` ՛` ՛`)\a ՛` ՛` ՛`(\a ՛` ՛` ՛`/\a ՛` ՛` ՛`.\a ՛` ՛` ՛`-\a ՛` ՛` ՛`,\a ՛` ՛` ՛`+\a ՛` ՛` ՛`*\a ՛` ՛` ՛`)\a ՛` ՛` ՛`(\a ՛` ՛` ՛`*\a ՛` ՛` ՛`'\a ՛` ՛` ՛`&\a ՛` ՛` ՛`%\a ՛` ՛` ՛`$\a ՛` ՛` ՛`#\a ՛` ՛` ՛`"\a ՛` ՛` ՛`!\a ՛` ՛` ՛` \a ՛` ՛` ՛`'\a ՛` ՛` ՛`&\a ՛` ՛` ՛`%\a ՛` ՛` ՛`$\a ՛` ՛` ՛`#\a ՛` ՛` ՛`"\a ՛` ՛` ՛`!\a ՛` ՛` ՛` \a ՛` ՛` ՛`"\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛` \a ՛` ՛` ՛` \a ՛` ՛` ՛` \a ՛` ՛` ՛` \a ՛` ՛` ՛` \a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛` \a ՛` ՛` ՛` \a ՛` ՛` ՛` \a ՛` ՛` ՛` \a ՛` ՛` ՛` \a ՛` ՛` ՛`\a ՛` ՛` ՛` \a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\a ՛` ՛` ՛`\ ! ՛` ՛` ՛`i! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛` a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛` a ՛` ՛` ՛` a ՛` ՛` ՛` a ՛` ՛` ՛` a ՛` ՛` ՛` a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛` a ՛` ՛` ՛` a ՛` ՛` ՛` a ՛` ՛` ՛` a ՛` ՛` ՛` a ՛` ՛` ՛`a ՛` ՛` ՛` a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛` B! ՛` ՛` ՛` B! ՛` ՛` ՛`! ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛`! ՛` ՛` ՛`! ՛` ՛` ՛`a ՛` ՛` ՛` a ՛` ՛` ՛`a ՛` ՛` ՛` a ՛` ՛` ՛`a ՛` ՛` ՛`a ՛` ՛` ՛` ՛` ՛` ՛`bpf! ՛` ՛` ՛` $ ՛` ՛` ՛`$ ՛` ՛` ՛`=$ ՛` ՛` ՛`X$s ՛` ՛` ՛`Z$ ՛` ՛` ՛``$ ՛` ՛` ՛`bA ՛` ՛` ՛`_m ՛` ՛` ՛`hp$2 ՛` ՛` ՛`xe $ ՛` ՛` ՛`A ՛` ՛` ՛`A ՛` ՛` ՛`A ՛` ՛` ՛`A ՛` ՛` ՛`A ՛` ՛` ՛`A ՛` ՛` ՛`A ՛` ՛` ՛`A ՛` ՛` ՛`A ՛` ՛` ՛`A ՛` ՛` ՛`ք)}uvʧ,Z.M#H}3 iIT }Wc%*UC'%tn}JBVn c}Ul .]3cc:sGa[MVߦY]zL3[=v'-J2g)#8eAkN*O" X7>oq4SdDAER!Z~FkfGC{ص(65M_uVR~X6ma9pҗ'5.FJ_Q[.b](J:,)sQrVmj6x#wz\\$ch׾K_Zj;1|JFu>FJ{,t29{%*o2ˎcS ҉n`cHh5;a%*d[uct|,JFnhͧ8&KM|/cbc(i{$Y#F'2b b-/`<2"Z^PLE g{0t . .. bin dev etclibexec mntmnt2 kern sbin  targetroot tmp usr var.profilesysinstsysinstmsgs.frsysinstmsgs.desysinstmsgs.plsysinstmsgs.es# $NetBSD: dot.profile,v 1.2.102.1 2020/01/28 10:20:24 msaitoh Exp $ # # Copyright (c) 1997 Perry E. Metzger # Copyright (c) 1994 Christopher G. Demetriou # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed for the # NetBSD Project. See http://www.NetBSD.org/ for # information about NetBSD. # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # <> PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ export PATH TERM=vt100 export TERM HOME=/ export HOME umask 022 ROOTDEV=/dev/md0a if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES export DONEPROFILE # set up some sane defaults echo 'erase ^?, werase ^W, kill ^U, intr ^C' stty newcrt werase ^W intr ^C kill ^U erase ^? echo '' # mount the ramdisk read write mount -u $ROOTDEV / # mount the kern_fs so that we can examine the dmesg state mount -t kernfs /kern /kern # run the installation or upgrade script. sysinst || stty sane fi  . .. catchmod cp dd df ed ln lsmkdir mv pax pwd rmrmdir shsttysyncchgrpELF(4P!4 ( 3!3&3& H43!3&3&NetBSDm5NetBSDearm9 0-D D0 @@0@TL0(P0PEPP03/T0H[%,p2% -l ll0 @0LT( R@ppGppP`03/T0@S ]Z% -pL M`QK \1 T1`p0\0: 81 0S  /S 0SP 00S5 0@0@T*P0PEPP03/T@0@0T*P0PEPP03/U QL d0 00 P0 0 Zg~XZ%L`0%,0%%< | -xLtPl@d`hPP ewipPOU P @(& P-L@ KhH0`  BR` pR R*X X/x&& -pP  b L00CS0w'p@ ZE0S TX 0S7  0T0R0S p ||_x16@' 0@ LA\]000`00816@0i4 0S !A16@ 0S $p @ T T 0S ^p Ip0S TMwp -sp @000 ^ip T@?0 @`&|&&x&< -@Pp`0L M00S 00 jP 00P@P p0 P00S(K @0 P0:T0`00 &x&`&% \Q< -LM1Vu/ @X$0%XS(0SK0P<0 S(0(` VP$壀$0S;(00$0( $`P  \00 KH3p$ _P`Vpx&`&$&< -LMPXqXa@T1tHLL$H00SE 0 }iP0@tH$H) S R A@PKpQ0: S J>0 P00S(K$@P0 P0c0s 8#8T ,T 03x&`&% \Q<= -L0 (& 000/ ( -LM@`P l0 K7 T0HC7 0 X `@(K (Y@v(& -L$M@4K00@K P K  d1-000`QzL@ 5 PP k0SP P0V;0' P P W+ 0X'pkV pk0-S tzP`PPL@p ,PP0SV  _& ( -LM5 @ T l0` @PP (K0 4p0 7@X50S 40S40S` 4```0S40S+ t$PG 00CS0%pሔ Pp  pYW @0 p00CS0 %0 VK QpP 00 :p pPB 'R,K0 K0 00 h30 ,K+K%0R00p0 0p p Ep ~  p̐,cp p Y p1x#0 C0P( @PO0 70: S200 pp R +H t+4upP-K ?-K0IS -KKpY Gp00T@@T ^@1`0S  0KR(  >@Pʯa0S  0P 8t? KTG`pL@T q@@0 00R0S 0  0 0RKP @P ll @0S L.P@ 0Rt0l00IP ( _&< ( ( ( ( ((&x&  ( ( ( ' ( ( 0-LMPAK@A p  0K0U4@ hP XXK0AK<@PAKA,(0P X _&  ( Q0-L@ XP HH00P$($0P0K0h _& # ( Q0-L@ \P LLy0"0)P$($0P0K0h _& . ( -LH0 Q8(&0$/ (0$/0 ( -LV0 -LO0* -LH0A -LA0WMf 1-LM  0 0 Kl ( 1-LM  0 0 K|0 ( 1-LM  0 0 K ( 0-LM  0 0 K ( 0-LM  000 K0m0 ( ( 0-LM $ 0q P2 Kc& 1-LM (0 \00 K ( -LM800 0 0 B0 K (0 ( -LM800 0 0 +0 K ( ( ,0-`LM!A!qPU0 x! R0B=00 B  P^|0H!@!7 Q8A 40100 KP O/=VP 000PS  $K 0p P4  04 00003/Q ! 7000@080L/D00 ( ( (\#=o (D%?D 0-LP@|P00!QP800 ` p0 A R0SR  ( (0 (0  / (0 (  - L.< -L  - L.< -L -L M@6JPKh KPK -(PLU@𨝈80 03/`P.8003/(` -LM80@0K(3/P $ .08 : S( 0p K3/P   00 0K00 0 1/0 QPXg0S 00<m8@ p-@P`LM, KL#80 (0(3/@=g P,K7gPKpp ( -L$MhCP` XSD @0 $KZ#K@30F 0 # p8p (1/0 QP$ .! 0P܃KR K0 <0`Mr<  ?P#K0#K0$ T-f0S$ < 0#K0 r# 0#1!W#! 0 ԃK40`# 0ԃK#$K SRtq!ԄK SR !$KDq P0!YX(:$Kq!! 0!#KKSR 0 0S0$0yz 0$ #KKR 0K 0  AJ 000L0! PAa2W0 4(Ko)(K0 ( ( ( 0< (Bf1 -LM2 @  l 0  P _Kf0e0}s'm,b%1#H}*Kb,*K@_@XP0!!!! d K !@PKaK " StRp d!dKKaK " S$R  !dKKaK # SR  dKKlaK ?8p<` !0V/0#a0 /aX dp`KKKaK y$K ( (%v4 &?RiN @-LI -LMa P00@4p! %@8@0 (1/0 QP$ , $K`尀T 80 $0(3/P 0 PUP@Dd 0S0C0PU,0  Y$?$ P, ( (<c& -LMxQ 004@  "80 @(04/0 QP$ *,=  (0 80"K0, K(3/P$K80 $0(3/P`p#SR $ 0P2K80(P 0, Kl(3/pTP #SR !QP` p `p0 (<m P-0L 0@M00 0K0. K /K -LMp K`$`P @PD+KaPKPNV@ -\@LP`UPE  t\PoQ ( -ML M<1` Q Q  Q 0S)(Ko$0P@╦&` 0S00S 0  P p0啧'S D \0`N@T(KK@\ G>K0CKKZ 6*P K A ( 1-PL@ 1 QP p 1 ɸP dLt pld1P `R3P000@1U@@@@Pc- 00CS000   9 0@0CS000l00 W0U0 c< 8L ş((((j(& (L (,D (\ 0-LR RS 0S Rt0(O 0-<<@L000(!S& PPP P100 PU0P0SU0T@'00 q 0LPPP 0Pp0P P0CPU0P  0L ( (c&D((D ( 0-DP@L00 00@0@000000(D( -`LGPP@  cM< 84@0p S@Dt0S  姷Pb* c70000 Q0T0?x` 0 b < 8L  @ j(&,*(((8 0 -0 L?0PVP@@A^P  0P/S0 @Pt 0p` `\0PH o@(<(UOh\, ( (u(< -`LP "P|@ @Xb 0``?\8P PP   P@P 00@( (P(&(( D0P-PL ,@ P u 0 0( (  -DL@|fP(0( 00000 S@(x&((@-44@@00  AR   ((//// -P`0LSp.@l000Pa 00CS000  #0`0CS0P000  (((L (j(&,D (A- px0x `t0PF@0P\0U00VXUp00(((H0-D @00^P0 0Q0((( -PL Mp 4KYUt2th^P4@K 0K)@P(K@8b P PUT  PtP00 :  R R1S7;^P 0KP 00SYA嘑S@ @@  P? aL\ XT00CS0<10) 0`00S^PT 0@0@00S P P  QP 000CS0\00@0  XY14(($(x&4 (L (j(&,D ( -@xPx`0L00h0@`0@\0@X0@E0@0CS0800 L ((((( (D ( -L M@p0P U U[(K `P 0崀 尐RP00@P0S1P 0S 0 J0 0 oP P@TP4(P(<(((`@-`0 @CT`@ pT00 P0S@XX0X x& -L M@r崂0SX pP_0`^ `Vx000l2Tpp`2pp00 P00] 0p0CS0 20d Ub10P 10 10Sd 10S` V`F]Z 40`0CS010?PU0 Pd1@ 00CS0 0 P U !Q00 000T````PP0 _ ~w00CS000 0@ _l hgh``(KT (0`0   0  ((L ((D (<((j(&, -LM$R< r000 040 200010S O@1a0<@0 0P80 @0(<0I?oT20SU 400 SRP ;0S RY@T  Y 0 0  4 00$10S@@ @0 1 P@000CS000 (K VS  v0P  BR p 8 @0S Y04 0((<(D( ((L ((&(D (0 -0L!S@`PP^ 0|EpP0!S \P ^ 0HH~HR<00S ,r$0@跺P(&BYx (q( -P@lpL`V0S vP c^$ KD莜 (j(&v -L MpP0` 00 R O@ȐȠU00U0S 000S D@@P(K 0R R L R  0 40 P40P@` (D(<(( -p0L!SP`@P`]; 0@' P0!S P ] 0LLL@00S 0T@G@P(&x (q -PL M@b00CS05p \ @T࡟A܁00 001UppppOP0 #] }v00CS0Jt10 P0@P@0 6 0p0CS0100S00 R 000 0 0 (K0@ K] h3|, 0`00\0 @`0T00T  x&H($(L (j(&,D (<((4( -L M$p0 P0 SPEUP(KE P 0"00@S0 Ub  P\8  00C0S.h20 & D00CS0$200 lU 0 C00S P䡟PEP  R R  `V' V ,x4 `P4  \D @< 00C0  BR  !  &UY PFP 00 C00SPF V0000VPPPPP 0P0CS0<00tv00`A4(< (L (j(&,D ($( -@LP`p @`U / 0@S@@ @^R00\P0S \Z lJP h0 @@P*0@00 c&&  -LMT @0D KiP 1[S( 0C01[S 0C0 KD (ht@c& `0` 0-SP0 R0LRP$ S ,(((P(D(O -LMPpP@ `X 0S@ @0S @T@@DT 0 rP 00S 0 0 0 P(K(<(D( -PPLpb t0t0S`@T>P 0 PP@ PO D(( T0-0L0084 ,0aA!R   |&X(T( @0-0L00 $0a@ Kh |&X( -L M䂟Pr0 ` R  36㤂嬢 @-T @%T[ . T $T T-00  R ,#U\ 4 Z4  @q J4 Z4 "QD  (K``+T ('Tc V YB! R=9T0T7*.TI /TQ3 Y /DoP Q  ?T ^T ;TQ 0;T000 0!0,^T-T b @^T-T  QZ0 0O!@r|Z "RQ  .T  <0Q 00-P4(|&(,( D(P(O 0-@p0P0`娀L00*P 000000 ,R;R 0S  S   0;SRp,((P(((4(p@- 0 P@@ SR@@\ paVQ B0T(X( 0-LP@@P ZG, ($ 0 00j(&, Q-L 0Q\SAo 0- LR,  @0`S! P=MpP lUPP @P *0 S@/R/    0 yD (D(!( ,0-LQ  @D ( 80- LR\ @"D (( -`q匁L10SPW h1P00S S L!`0`00P0S00 S@P0.S0 S 䐟@ 0007PP 00CS0$0 \ V  T d0 00CS00 `P(4(8($(x&D ( ( -L M 0`R`FppVRQ0 0@00wtp00 1 10S M l1 00CS0M=?(K iP00CS0+  R  YP A R#;`8p p  R000`00C0@\0@0  p`P(D(((D ((8( ( -@DQL81 0R``S`qVPBP@PD`B@PU.000]P 00CS0)0 {" .Y P  h0 00CS00PU*P`((P((D ( ( -Q 0L0@0P` 00CS010 5* {PpH0SӉ00S c 0@D@@C\0pT0 0@0CS0D (D(8(( ( -L M2`0pSROPB U$t0 @Sl000P2XPPPPuPRW  00CS00& t0P  R/ R 00 OP00W }|v00CS00    BR    P0P0 P0CS00 O P0P0`F`05P  P  X0 00CS0(KD(D (j(&,( ( -ALpXP `0C AR1 0 C000`P WL 00CS00  Y00CS`00 \R pR pD (j(&, -L M0D00 0@S 0S $0KePp(K00$S/T SPPP ( fPV 00CS00  0$P0CS(00! P(0( 0 S- R0003U````'P0 0`0CS00 (N#0P  !@o!S? %S $ Z)0(0043UP=V~ %00CS00 k0$0CS(000( 000\Q0 0 PR$ $ R0(002UP 0$0CS(00WY0 (0 0S 0S꜁p0$pS Sp|  ( P 0$p0CS(00*,0(0P E S:p00  ,0S pPQ$0 P (00PE0 BR0    P00(0HPQ 0$0CS(00 D (-4(j(&,0((L(Ep ( ,0-LQ  @D ( \00-0LS@ 0!S 8nRP /CP 900D (- -LMA00 S1"Q,q`WX0|000PC/Up 00CS00. 7000 @P R8 R  KPK0!S #P @ e 0 Sڼ P0,q0CS00000 0 0  \00mP 0  004(|&D (j(&,Y0(j -P?L0@ @T@ "C`hV  1QVB EVO !Va =VE V??P? HV PV GV cV WV aV VVeV :fVx gVqV 9lVb jV1 (o Pp  @ 0n\O p\H l\I 00 SnV f:pV|>qP 0nP pP lP 00 S ? quV1 2sV8  >UPvn NPo>0SH pW=0W@ 0nQ  pQ lQ 00 SCh=0Si vJwV /:xVs zVs<=$=P<0010CSx 0nP pP lP 00 S<<00S@0 0nQ pQ lQ 00 S   @@<<0S \<2PP@NlP 0nQ pQ lQ 00 S;0S ;;dP@0@@pkP@ 0nQ! pQ lQ 00 S;0S <;;;P$+0 S00@0@@* R *4!R@ * R4 000@ `P @ 0nQ, pQ% lQ& 00 SmH:Px Pt|P@0S!S  K0S i,0S,`\ N@0@@KPRk t9 0)0)0t) R000@ P< 0!S( @ 0nP pP lP 00 S0S JIq@0@@|x@TD8PG@oGFBoP㨂VVP 0nQ pQ lQ 00 S000C@0@@70SH 0nQ pQ lQ 00 S@'0S! 44u@0@@h70S( 0nQ pQ lQ 00 S,'810cS81@0@@0S@@0 0nQ pQ lQ 00 S\60S@@@06^P 0nQ pQ lQ 00 Sa50S55P :c@0@@@0@@x50PQ 0nQ pQ lQ 00 S 2X505vP@:@0@@4 P-tdP&40SXz40Xv X@@ X@TH 0nQ pQ lQ 00 S 40S@0@@3P 0nQ pQ lQ 00 S  @0@@ 0B  30S3@ 0nQ pQ lQ 00 S3 R" R#  @0@@30S0 nR pR lR 0 S20S@ 241SqV@@000@ t20Sd2 X2 `P~ @ 0nQ1 pQ* lQ+ 00 S_10SR,0S0!S , I0S,0S a1LPS 10S l1 @0@@la0 9R'0Rf* RU T( 8130   \  R]\0 -LM⤁`Pp0 SS(1PG(!RJt,000d1U````t@P.N4 0,00CS010 [S@ \S @p@P0 S|@ 0(a0CS,A0t00,A G P0 0pS 0(Koh4( (L (j(&,D (Z<( -(!L0 PB@ P00!@R60A0S S f`P@ P0P 00S#@0@00 XP0A p0\ 000AZP@0N_0 ,(4( ( ( ('j(&, -L M"R0%Q Q0Q0(K N`AQhu Q@%PoA2 Ry 0001T````sP\M 00C0>\QK@ Q10S xxaP2 00P S,00 S 0S00  T````4P00zM b[00C0S{00z 0`00@hp@X0`00CS0400cH 0@  V4((D ((L (j(&,8($(x&( -@䀟@0@L Y0Pp`@ P" 0 R00 R000 1BQM@ @X@p M0"S,@gR0004((  -LM@40 3s`0 80 80#0 嬃0FSP Tc0003T00PP 0P0CS0H30?A 30 10&SM 0AQ 00CR@:` QP\@0 < ZP< @0L 00C0S @(KH20  PAQ \S0H 01BQC40 BR?  AQ 0J R@+` QP\La@ <0 P<0@  DL ,%00C0PAQ T`<0  T  PP<0 P P  BR D ~  `@N((((L (D (j(&, -LM2 @" 0P2 40S 0 0 $2 00 ?KIPP (K@b8R 442S PS202 2pW 2 3   W ,(" gP("K   B R30  \3  BR P3030S 0 y "D0 Kz@P"2Q Q 000""2 0 0?K P 2$"Ph"PEp0ZnP" PWppp 22 P2"N>K &00C0S pW,ڼ1 (2   W , " P "(22 K\p lh2  B k<  BR 010eg00S 0  C@|0p0CS000HJU ڃ?K 02 X00S 0  gC@ <aC2S<(((L (j(&,D ( -pLM`ḁA0Q0C4 8 0< 1< 0 0C SWQOp~  80 4P(K5 LP!000 000 _P00CS000  X  00 S00CS0x00pP   P(((L (P((D ( -LM 2 B b@ prD0  0s (KQ0S 1 !0 000 PP@% L:!8PK J ^ 0Gt10S Q0D 00p0@0@!000CS0B,1: X ԓ$$     "     B   @  CL D((c&(( (L (8(D ( -PL` 0 C,r 0h 0 `0 \   BP L @pT S'@(((c&D( -P0 @0LRp` d000P@ P0@ @04(@0 4"@CI, (+$$@@(j(&, -L 0 (& -GMLM\5p PR@`<%QGK454A03/P (K:K,0C1: SI00W K+ @@tPDH?0GK4AIP:K,0C1: S 0S GK4A.P:K,0C1: S 0S 0S 0/S.GK4AP ?GK4AG-K0P8 B00SEP0 \K @P  K0#,@PJK,@DK+ @@K @0P KD#P @GKK4A @P z/\Pp/p\PE0P="GZ9HY6U.0B~K pG0 G-K< B0 @,0K G=K<0C04JEKAPT.00 @,0K ICKAP K,LL)LQP!LSR G=K80C0 ?oR2  R 0S= :K,0C1: S7P6   R0S/ Th8XpH DX00CS0  Pp  YX  X0 X 00CS0 0 30S ppWP 0 hB R;c 00(<e &x&(&\\D\0\DX X0-dDT V H H0R\\D/0X X-dDT V HH Q\\D/X X0-cCT V 8 80R\\}D/0X X-cCT V 88 Q\\cD/X X0-eET V X X0R\\JD/0X X-eET V XX Q\\0D/X00-GX0'RT00\\D0/X -gX 0GT V \\D/5S %R R S R0 S%S D\L\S R 00/0/0<(( -LMQ | 50S50S50ppP 0@.K.K-K/K/KP P P P P P P T0SY \0 0Wt X0 s /K&K/K&KL50S0T0 NK45 B@_?A%KKB4T 0S$0@B?ET 0P0 0KL0 .K $wKB0H $KoKAx4D 0S0@0 -K KT$`KAH4@ 0S<$0@B?E@ 0Y<0 8 4  0$KIKA 0#8 KAKA8@0 \ 4 @ C@Q8 CtK03/0 0l30S Xp]5 SS $M\ LZ 0!43 @^!RS3 00 R0!W0 X`'*K K.KR0 0.K!KQP.K10 R0!0 '-K K-KR0 0-K  \ (tŸ0. S 0dŸ. Z0 /K K 0 K/K/K0 /K10Sk 2QD 0! K0K0 1Q? 0! K0K0  K=@ĐU *FI?K JKmpP(K@$Kw K? @IKP=w0S K?(P$PK?j@P& -L 㘽<(& 000/( -L0 ㅽf(& -L$M $ 0P ! 0$0A0 0P0!1  ΦF KQ+pĦ K "$ 0P @0 0 0ph0K 0+pX   DHQ"$  (0Q(_ D< -LM`@PQ `Pn =0Sr   t`-P 0S) P d Vd00CS0?fpp W 00CS07 Yp7 pYW `(K0S P KP{pPKf [ 4 Rd`N0 K0 p0 P 0S  KhP 0: SPDKW P (B0: SP Pإ `0S 0/K  `PC DP``    V 8尥P $婥/K ?/K0S KeK00 1A?K0AK //K `0 p|  p|| K0KK0K  P 8j  P l<0S ]0;0  P R@ P U<0-S @ E QPQpPh`V  <嬽D`((&x&~ )ŃE<UY@v`n p-L M@$K`PPc0P U $$ KpU $\@$ 0 P4 @Dc&% -~ML MA~lK0S,`F 0pKPF,H t0F~AP;X! ~,P ;0!3P(K0 0F~$P; ~,PPʜ; ~,}P0pF 0F~PYp  !Q `30 00FPr;>$ g3Dc&mT4|00CS0 ޽0 / -LLMDPp Q000d$t000 0000SlltUd4d$P p P4Q !0SJ^,$ P;0$3U0#03 p 3Q  #P0 0:0#2U0l#0P3 P#P :0<#2 3,# F$3PMP:20"20 0(Kmp 0: S|2 U2 S"d K+P000PQ+(0pUUyU00u U!424"00,"000 S0 0 00l20 QP:0S0 00 01Q>~, 4Up! R   `B^ PQU 00 $1~,s*~<~lp00 ;0  K05lVp0YU 0W,U (U&Kሀ|0`V K ?50\0``Dc&(0(g&X(Pc&\(,Xc&Faac&h((m8@P(8(pc&} -~MLM@00S 4@0S~K~,APK(Dc& -0L Mx@$0t00S K0 0010P 9, 13PDc&( P0- LR<[1P 0 0 O1((8(  -p`P@L PPEU`@T@ -p`P@L ]PPEU`@T@ 0-@LT `ڤP0 SR@P 0 Q @;;S B@P00T@ S9(0( H1( 0Dc&(8(T u  -LM(Rp@`TQ W0q@$00F P000S S1TIT 0$0Pڀ;;S 0 000P0 P?qP@@00* 90S@@80ES80SP80 S@0@K80S 80S 80S $0STڄ00Q jQ`e0T( L^08(00 0$Dc&(  ( u  N  -LM\1 R*PA R& D!  BR8 RQ:QQ6R   K $ KP000S&0% Q`PV Q0P lK0P0 03 V0P?0P0  $/K(Dc&g& m   -pP0 PL M` (K@PڼAQ0P0 0QP 0pp/0P08< 0P 0SDc&(  -LMA`pPP:x10S8 SV0\A00,V00 /P07!/ P0R(0S 0/P07 / K Pڌ0V 0?30 dE/0( , KL2KP7(0, /Dc&(C r   8(m  -MLNP (K#0ST10S 0S@XIt (1 &000S0S000001 R(00(00S00S @P0S 000S 03P 0@0+0 f1 0dgH&LDc&0((((`(t(( (X(g&d( ( X( H( -LMM.K BhP5T#-3K AP5$#-S0S c$0S 3@T0S2-r 2P  2P| 0 y S( .--2x00CS,|,x,t,p,Kh@,PKT@2P0@80@, (2 $K,(<[S ',[R KA6YS. )SS,|,,K@,PK@U2P (<[S K@K2Pt K@0 P\,sS ySP0,0S ,@(,K@PP K@P0@0@,KAj,0(  (Dc&H(((' X(Xc&Pc&W } g& 8` 1 `(  U|7 400-L@ap0op`0g& -L MlL!\PV#0V`@XP@% P PV 4$@$PUP; xP8T00S $,L 01#00 3/P0  QT00S | ,@ETh Ad 14p4s'@0p(K(+g&xf&x(g&g&y((B -LMQ0@p`0ᐡ0@ G80 80S P`V4PX+.PT-810S0 ,+`0@"0$0 3/0P& 0 R T @ AM0 0800 K3/P0P0t00Sx t+ Q < 480 2/P80 <  (K(x(`(mg&y(0( -LAM`/G@PKpA^K PEpQP/0P0 V`0` +L0o"+/0P0 0PP0 +d(0x(D00CS0 0 / -L,M0C80 0PY P(K? P0,03/P000@0 fT3K0S DsDcPVP PP 080 30SJY ( P U!P#P ꤂4 CSR P8Kl do  P8 37<"+ H_ 0/SP.  AMX 8K 10S 8 P0S !S$K !x000@03/`P 8KT X `1  0S DQ0S ,1;008K Ph04 KD083/8KP 0S ؀0S 0 `U0403/Y ㅽ00S !"*KP0h0CP0zPvP(l((`(h(`(d(e((t(0(`(0(@( ( 0-D@L Ps2( i*0.0x( 0-Lfp@ K0h[2 Q*0 0-L@#pL20 A*K0h p-LM`ᔾp@920S  S S 02KP}p 0: S %2PKpS NS@ -LMWP KQ0H03/P0 03/P`plAPB 0AS0, K@0a3/P,1 C"K0P)3P/P eP0/SPp- A0 0006@ 1t )0(03/ X㑼$0 CP(`( (d(e(&x& 0( -LMP(KTE0H03/P0 03/P P㆚5 K0S 5忼P x1$n)40STjE$P 0(03/ B 3%P 0AS0 K@0ad3/PX4؀C,Ke8P (4Ѐ C:P 40S K厽P s0S30S K偽P 3R0 S =(KR03'KR0`PLP 8OS@3(K0/SP, A7s0S20S KBP0SU 20S =(KR02'KR00S "SA-K< 4S P P20Sd@20S Pp4S S/ 0CS)K 0S%q  GX G0S% q0S! 100=(KH4 l1 $ L0Sp,pP 1p Ѐ G G0 K@03/0S 0S p0S 000ZX0؀C,Ke4S 0S 0((g&l(`(0(`( (H(d(h(T(о((e(D(,((t((g&`( -bL@`PP@T  T 0 'H03/P0 03/Pq0S0 X P0S t1t p1ޱ d1 PL10S@aMP P0  DP0(03/@PH.P0S00S @0S 0h 000P@^ tኺ0S PX P(2h(((_t(`((`( 0( \0-0LSiPP$00H03/P Khh(( -MLM0TÎK$< Y' P`10[/S &p0W3MK/S/000p @D0`PI/0P$>'(K<: S , P PsP40S$;f< Sn PԜ "P30S30S P= x/ P`+f/Q  &<P 4&N0P0"2 0RŸ S "P0%R0S$^P x dPp0S'd20S#X0S L20e  <2 8"000(20S, LP+0Sw Q0Ss 1 00mP0S 10S $]R01%R0U]$dQ4S S  , 0CSD EP E,MP \.7 Q& E E PKA E  E  EKA E 0S `P0S L0<|( l(`(h(T(0(d((D(,((t(`(0(X(о(`( 00-P@L00S0000 ~ R~<Ôʂ;;S <|%0l0 h0 d0P L0 0 000P(P(|((F8(pc&X(H( 00-@L000S0 R ~ R~<Èʂ;;S P <0 (K($\(P(8(pc&|(X(H(g& -@L0S 00S$[P(P0P`pzP 0000 @_@ R PR H$P 0P -Ppc&g&6X(|(k 00C0e%|( -LYM`=p h $_Kl! ! @P Kda J%820S KP,:8"$WKP$`Vl 0]K С`a 1 pPD[?K_K R0  P]?K ?]K q,0T!f$lY?K0P`>K P],P:8!P$[?K_K R0 d!R MP0(K=]K!SR 0*(#WK᪸P.,:8P "$G?K(KSR *0( $(|(pc& -@L 0SP`pPP 0|000 `` 0S0 0P$0 0P |(pc&(X(\( 0- @PLM"K0$K@a B?P 0P0 1p_0 *'G1"0, KPlP"K@T#KP 0@P#K 0 0T0 @P0P00 P 00T@P|(8(X( -P`lpLV @P[PPEUPP@@  #`F|( -LM=Ё0`QP 0 AK·P?D@TL0 q 0@ 0 X0 @P PRX00K0 0KVP$0V R =P0 X040 0SP(K+ 0 "L 0 R   SQ0XZ4 S <"V0 0 |((> -L M10 P0p㴑a|Q9 @_0 Z p0-  M# 000 SJ P08@" 0P  1p 0 @00000Tp(K00C0P @_0 0 0PBp #00t00Q  Q 0 P0   0 SB@(H(pc&|(h\(( 0-8@L0P0P E)0PK0hl|(pc& -pPp`LU @PL0YP U@@0 "00pPE|(pc& -`pကLV0 @PX04P_V0@@0 P)`V00p|(pc& -LMP =@a  UK"X10S UKUP):8(!! V00" J(g!8 @P0P`$K?V  ᙴP0`VK PJ)8X E?K'KQP J(@ J)8, !`$(|(pc& -LMPKصP\0@T@ K [bWV *KQP ! K@H( 0-LMPK@ᳵPK000S0: S|[&PPU ;)0D 0!ဵP 0,)0 H(1 't(B 0-LM@ K+K 0 S 1 PR 00SKgP#0S'Kt,KE 00S&Kd+K; KᢴP (0NS (0T  K0(08 0SKKpg&g&oS -L@P`MP  P $0(0  t( 0-!L@P0$0(0 K0h t( -LMP0p/S`/(@P: 0K0P/00 9p /00KǴP&  P!0S  ᤴP KἴP[0 KD/00`v (K( -PLP 00/S ,AP 00Q ,Ko_JP#(00  `0S 먀娐p0 P(0S@$<cPPH0Q4< PTꌙ( +`(B (t(L -LM`PK@p9P210S K+KQP *KQP d0: S$P \P'0 PW ֲP ' P W@0 H(]1 { -LM:(4P: S=!R `V000K @0Kγp 0: S ,K00 Ku:P/  0 g -LM`QHZDT@HP@'0H!5@1P @$<b$10SP-(u00S00S 0 00! "4S `6P '`0 S0p 40 K(S(LpPjh000((((g&g&`(( -KMLMZ#Q30`@ (tp; 04 40CS񟗯H """"""3#Pp30S KA0P4 4: S dZ!P &Y Y30S 0" vBK" AspV&0"Z 2P @$<댒P ?o20Sn(4`S42T~#P ᤲPuKAỲP`[&0 "P0 + 0S10S 4m0C?o2 000! "(K,0K4BNK4@ @Dxz=0 CձzNz 02p P@@$<lPl84S(4R0(4 $dRX00>0S4(40S0SD00S 0(K#( (L(((g& g&8j/ -p`@LM0 V00DP 0S0 0000SPP0C00`F0S 0S * 0R 0 0 w w0  P; % 0 W5@?@ rP0,% 0 ~0堀0唐S .P0 p(K\\0꡾ 40 V400000@(((( p-RL M`P @0@ ,P0C%0@ Kph6 ( P5%0 Kp( 0-LM@PP(00<00S  = J"K0@( -j@ML,MpQ'T U [# ;K,0C K@0 ܯP =K0C0 P=! SR J(|(KKAOPJ$8| ==K<0C#QPJ(HP0P P0ȤJ$8  + -ALP a000pPU*`00CS0pU 0 0S U 0 qP 0` PS0SP 0S0 0 S P ꜙ(g&x&( 0 00-S00@L000S000x00S0@000S XyP H0P,0P00(((( E@( -PPL` 0S| P@Pd @P0/S0080`f R P`@@@@t(h0 RX R  H R/< R/ $R/Q/ ;ꜙ(d($(P( l0-0LS T0TP@0L`T R S0c ᮥ0@@((j(& -L,MR@ 0S0S࢟0@(K0 0P50C S>----------x20S X<K!4KP 0 000#K #K U}P`P   0!$`$![ 0!0 㓝 Iz X B(4 : S@  S:  S  S05 S7  SG  S04=! 0410S ̈́!!" # "0 0 J  0* @P@g 0 `b040+04 P"0 00  0ꜙ(M@(9 (  -`p`L'PgS+ 8  `(j}aǃ -L\M@="TKp:hK(凒0T KhKK 0-LM@Pp 0P QK00 KKJ`F`0S%* P R 0B \0@ AB\7@aB\/W@S:/ 00@Q/ 0B\//@-Pp@`UVUQ.0C\`p0S*0 \0W0C& Ό' `p0 0CΌ `p S*CS*`p PC-a*0 @X`t0? S YXJ T(\D\0A  Q R 0 S* 0 B^QA^Ÿ 0B@ T RB(^Ο\AB@T RB(^ Οa B^ RB(^ ŸR0@- 0C\0!S*00P@U T0W0C  Ό! 0 0CΌ  S*CS* 800-@LT@@  0( -P4P M70S  P' 0p00%  XPTPP'P0U00 @ pP  P00 PP @p6 P0BP,@0T0C0 #@GPNP! P:P@T t1Phf d`P gP PeU P_P PUXP x50S  mP  P P5 00(KzR`QKKKKKKKKKKKKXQLQKKpQ|QKKKKKKKKKKKKKKKKKKKKKKKKKKKKKIKKKKKKKKKKKKKKKKHO`OKOOK,PLPKKKdP|P|PPPKKKPPPKQQ4QKKKKKKJJKKK0KKKLKdKtKKKKKKK,N8NXNpNNNNK K0 T@$Rb0d0?o0cs00CS0 㧞H(K G8c(K (Ke1P 6 l2 (K 2 2 (K ,2 1 (K % 1 (K 2h!  \1 (K@  1 (K  H1 (K, (K,(K42uP2p0`A R(K+ a@BT~hL$N$N$NpL$N$N$N$N$N$N$NL$NNNp!00000pn(K#((xc&D&g&(&t(&P(ZX(pH(g&v(ș(((g&d(l(h(1"g&g&g&g&g&g&P((xf& (> \Qx&' # Gg&!K!`KL(X(g&I @(h((xc&h8(_ u (&} (@(  T( tc& ( H((((D(,(g& (0\(\(0y0w1(K+j<0\Pc(K*b 0 (K*\ 0 (K)V 1 (K)P(K(Mp,K0,aL0 01 0L0D1P(K(< \\h#Y#ppL#Y'<1! 1 (K' daA1P0 0!0 0,(K'  1 (K&(K&(K1p bP00x MPsPg02uP(K% |2 (K% 2 (K$OL2 "0(K#2P(K#2P(K" 3 (K" 3 (K! 43 (K! H3 (K0X#0$`3d3 h3~p3p#{t3Q P00i? ) 0HK!PU@T0 paUT00> QB Px00R?  C@ 70 fHKPH 0S0 @+SmRRlRlRR@0Yd PG00000YOI 0DPP00000 S <0 = G 0.(&(f&D&o!|(tc&0P  /ș( p00-LP0\0\0 ~L@LPP@0@P Ὓș((!!(&(K# -` PL @*R7 R Q. %?R& [RS\ !^@@]P2!NoT^ 0S/S RP PS\ PS0*S S 0PS 0 P0P p-W p]WW \\ @\ P( 0-L@ /TN@@N P0H0\A\*0C0S*0SaO# p-ML M1P@`KP-K/P K P <[S}Kp.SL[TxsKh`m.KZ P @K(i#### #$8$H$o$ -cML Mc=K(0CKK3K#4@Dp`^KW: 000c=K0C -Pc=K0Cc-K0 B00 ;RS@X 0cK$A0cK; A 0c=K 0C0T*cKA00Q DXOH(K&Q< \Q401CP)cK A c-K$ B 00CRc-K B2P ! R0BSc-K B  BScK ,L08c=K,0C0@&S\ScKA  @c=K0C c=K0C dc=Kc-K 0C B0 0CP;TG 0S 0fX 0TP* R00;T 0S X 0 pD JKX,@D 0 8TS ll8TSo 1 @  c=K(0C0(0 ( ܙKܙ( $$$(&$ -LMPP R`p ug\Sp RI p0S "00p0Sm\Sp RK pSS) GS PS! Y 0,0C5pS sS gS0000S00 R @@@$K0000㻰@P"  ᤩ`P B.K; B)B.K0 BX` P 9$%j%ܙ(A%% -`PLp 0Sl}@PP P`P80 PP p@ @@ @%%ܙ( X0-@0LPL`LT  S, 0@ܙ(j(&% L1- LRD jDT@ (PU: P7\Q Q 0T+ᙲ04#uP ~0S/  00P0S/  0P0q @0/S000 0DP0 QZܙ(d(P(&6& 0-j40L@PTp 00S 00S0 00/S @Tt0oqPL0D0S pP040 ܙ(d(L( |2-0LS@P' 0`.S0.S0S/S 4P0   0 R CR S.R S.R0S/S 10S410S P:4 CSR ! xaPU 0/S20S.00 p ^00C0U00 PU>_ !P:$0BRSR;  P ኶`((x&&`(@( -@` P1L0S"ӒUp( P  0 P0C0 B,#0 @P@ Uffffff@gf ffLfU.S PP 0 00C0 B#,D\< 0 00C0 B#!d v>C 0C0 0B0@"000 @ 0C #10C0 0 0C0 B #@ 0 0 0C0 B #@0 0 0C0 B #0Ւp`d0|& -|ALpPW :`p000\:0L0  - R 0R$ -MLM0A R0\p.@0X!XaP^*K$ B0  C0/S+:K40C$!$KԏKP6 K *R K$H0@C:K$0C 0 C?R*K$ B0@C 0ꂀಀK$H0pC:K40C| tK⨏KP:K40CX LK➏KP:K40C0 KⓏK|&, ,,, 0- L , -L@Q`e\ 1e #KhN LP   400S  /((x0-@^\Q 4PP(((  Q0-LP 0S   pPd @t L @ @T@000@I#g&, -`pL@PP P@ P 0 X{H0@ Hv8000CS0 $ 0 4->-l-g&-(( -`LMPP$K4"e :0J840K0CS2"`40 !01 +  da (lZ <tU @ |0 Q}P  E=-0B0C2P0 1P) (5P/\+ $ (8$K@QaKP  v⸀ B` $($ *($ /R00C0 $ 8$($)Ёpx0`(B$(( (( -LMZ@0@S' 8Tdt30S $KJ(J(J(J(Kd h3i/K00 0P J< SiK"L01K3 0b JK"K0A 000 Q:0A Q*J(X S70001K=!`rp JK"K0A 000 Qu:0A Q*FK @w`0m/K<.PJ6`0k/K@$PJ,!0 ` 0`f/KP J=<@ZTqYEK  @ xX Kx}"K.`0c/K `PJ}"KP P@ PP P P0 ``X s 00bR cP(J0j0r0I# z0((00/ 0 0p(00 0-L@z PP oK0h0 -L M0P-S0S) Š`P% 0Q K(0p S0 E(P(K@P,0V \`p 귺0x&0 --L M(@P   K<( -PAUL`<0 R l;P @ @P@<( --P LM00 |0 x00Sl00S `@0S T |F00D0D 4- $帜 nFK\(((`((&(= 0-|LPPl0h@P \)P 0000S  01<(l(1 -0-P  LM00 0@ 00S00S P0S t F00d0d `щ P\T< 0ʼn( FK0\(((`(&(=(&w~ -L⥤ 寉O*1(& 0-LM(@P@K00/SxDPl?PQ_Kp K@p *KQP)KQP }@;1P&1 000/( -La k ?1(& -LU _2(& 0} -@LTP 0QQ0P0T`0000000CS000S (( x0-`P@ dp L 0SP'U00CS0(00SKh((( -@PD`L0S@'T QP( -4QL0@00p7 `1S 'RT P10@00CS000S 0 SPp吀AT$Kk$70U0W00CS00 ]U 0 ((>(>i& -0PL2 R' 0( -Lp`PU@ @P` 0-\PL=@P _DP0P 0@00aT,@0H( -pLtP`000\6@k60 0f6000@0CS000S$Kk(( -LP`@T FPV 0@@ -LP P-L`1P=P#P 0 $UP@T'UV00CS00 T 0 00P pi&>>i& -LMh3hS@`c` 0 (K>43(0 0" (0 ( 000 B p2 2 00`G5먒 >0p$K+R 1!Rv  R R% Pi R000 R@(Ry %Rg &R0&S03 )R7 *R0=S  0& =R, /RI ,RU -R -R0( :RH <R0<S =SI ^R: >R ?R%|R ~R$ #000=S& >S 0|S0 0=S0   +R0' &)"0 0|&( 8|(p( ?x(R? p-L M0P0`0DX0`~0@S P 0R@P@ K J@P0S 00S 0ST P50 0 0 R  Kpx(l(h&?\ 8? @-L@`PQ ԩ@h|XL,d40\ URq4 P 05"R?  B 0b4?  b4 0R UQUR0V0V0R0SRSR"#??? -L Mp`렠@0P%SJ000 0&S `r4=X0 800 S00 0 @P@P(K(@p( -L0M0@ p$KT` 0 DK@PK0@P SW@PV D@ 0 F'@P@ 8K 8KD2Vp( 0-LP@0)S0( -PL(MP`p[ P2 P82 ; 0*P(2[ P 0 @P$P[ ܑ"P0@#SP $K'0@SRO 3S @P'0G\SpX r@P'W 0 !@Kj @KU0 r0  p0@ f0 000@0Pt0 V0 t 0MX4`/'U@@PP 0@P(8@p(@@ -`L$MPq80 + ,K a@< %0 <C@0DS )00S^^* PU @ 0 4 0DSL0800S Q` (KUU p((42 -L Mp0@ PB\`0@P0SX0` P00 0@@U@P@ K(p( -L`h0@0PSP0p 000  00@@P(p( -PLMp0K2`pLP 0IS0NS@@ P@G@T0T@PPp0`Sp ,20K2K|(((J@ P-LA7P@4 p!a 0 P Q B Y Rp0 R ԥ åB3 0 P @:30pR å23 B2@@0P@ 0$Q0th&|h&4(l(3@ -P 0/SSS00( -`LL1P4P 1H0Kh220"S@ V(f@ p-LMM0` R# @P 0/SS_Kpp Kp +KQP *KQP1 0Kpg&}@1 ( 00S/( -L M X4c 0S)$SP C000000000CS020S Q  S (KoS(KolU]12pt2tR0pr00@/SKXXCPR0S /00CS0ĥ@N2@X00F20001A  P P 001 eS |aS00CS0RX10SN (Ko00CS00X0ĥ@20X@00 R0S/S0@D00 P  R*0000t/S0S P 00CS0/00ĥ@00 100@0H0S 00CS00إ0ĥ@10@0(K((((z@}@(th&4(|h&1 0-PL0@00_P 00CS000S 5@000CS0L00S &T 4060S(0Q@ O@((h&(j -LM020B`7P0@T S@P" 1R@0.S00.S000/SS?10 Kk PP>Y% qPU|`Ph P 30P F0Froo@`0-S0S0@T0@eSP G0K:P0: SV 0.S0/S0S:P$Kh&H((@1 <(@(@@(@ -L;,0Q   KhR Kh(}@@ 0-L@PL60P000S w@LT0@ Q tQNh@00CS00 !N 0 04H(@((z@}@i& -@P@pLW\B00CS00 M 0 a`PP ZP`P`qJ\T Qc @eT] aT^ 0TG \T \@bTN cTrT @ 1fT @ nT @00CS00 M 0@ 0@ T0S 00CS00 M 0 0S tT @ vT @ @0S  0BPA0@D@@@@Xm @YM0i& -@,` LRP 0R 0S SAM00S0 R M0 R MU  MTMכ |Mn Tl@00CS00 $M 0  KhMpi&((=i&(<i& (0-0LS- (( @40-,Q0L00 ZN(( -LM|0@x0T   $K@$@ @ @ @ D00S 8060S K((4(h& --LM 0 R    ( --L M  0-L( --L M0@0  + -L@P`  @--L M   @-L  --LM00   K 0-P@L K0h --LM  K  0L -LP8 4L,P  D2A(0/( -L@WPPPP sp` w`P gp` k` p-PL MP `0``6 F 1T0@TMD0 @0 1O@Kph&B (( -L MP`0@S'8<0 FPኬ 0u`pწ0 ᆰ '~06S 00S T K 0p0S0P.S (N@`B0 0 0 0 0/(((( 0-LM@PKTK00P 0CS $$  n000@P  c0 4 0-LM@PUPP0K xp ,P  PP0K<p  ,7K0C00(g&\Sg& -LM@P 0S0S 4P 00 0 K5 K( -L Mp0S A0`00b$P\U0PaSP'00CS010S (K000 S 4KP V<6w   *P00CS00S VB00S40B V04`P(((eB -LM8s@P`VP. UP\@Kc,0S 0S FQ񟗬0L@L0p\````````````Up2PP+V0S#L20S@@K:,TV0S 20S1V0S10S10S@KD,10S H0S\ 1PPUV I@PP%PtV0S 10S 1 R @T@   @0N 0?o20El0@T   @ bJ4I (Kh&(zB(((pi& -PLM8Kp@+0 ~P㠀堐}@P` 8K+U|0PW V V0S W VP00P0S8Kt+$Kl(`i&h&(( P-L?PP4 p ` 0 @ Q B Y Rp0 R ե å+ 0 @ P+0pR å+ B*P40$0 0 th&|h&4((( -p`P@0L000V0S0S 0S00CS000S00CS00000CSl0`00C0X0` H R0 S[0`SS((h&( -L,Ma@KV0P S1HPK*q@DP TVD q@AHP  U㔑[ 0S. 11x32I|0I .I00CS00 H 0= J00CS00 H 0 H  eLP0VP Q QAQP  R @QAQ  B @K|*(Kh&((i&((l(J -@L$M@Kp`.* 0HK D 0ȀW@T+ 0S0PU@ 00H0\P 0tt R VPU 0 SP00@U0, @K06*(KP0l((h&( -`,rFoL@0婒S' 0S$ 1Q12pHnHZ/iHVeH00CS00 G 0 GxQV000B! 'PF V080! $  C 4DP!P00CS000S A00CS000S V0S0S@0@0J2HHH 0,KoGVh&(i&l(BBB(((B p-LGM$2( 0,1 0$1 00 1 10S (10S 1 `12  GG(1Q@TG1HGGK[PP% t1,! 1@? 1S @T D1Z B@ G4G 1'G$1S  1 KpAG/K0 000 (1A$Q 00CS0 (1@0w0,!00t0 {?00CS0 1S rGlpGL0FX00S @00S (h&(l(Bi&B(B((B( 0-L$M00`o00 00V PRPp5@8K(0@K00P '  &P00S @<>00 <@0 000CS0(00S 8K( Kh&(B( -LiM@? 0A 01 ? 0SK1 |?! 0xA 1 l?p@P(`?K@X?`P!l  !@Tvl1(o@1 ZKP1d @T 00/Ps0d!1 0p1Sr'p1 S!n01 >60S >0S1S10ń1 Ť!11C1 X>0S]1S phA0ShAX F4800!P1  4(@00CS0 G080S IKP 80S'0`S777 h! I/K UK`70!h1101 0!$0hG01S! 7 70SU uS60S `彀\<&060S c1 @1 @Ft >NK0 0<01 0C01P0042P!RQ1S 2!   B 1SVSK% KP1!SS|1 @0! |1 @@Ip101 1S`1  1SL1 @1 1S (1 1S 1SV?K0S 0 00S +; F@T1SQ`1!\01! 0H)F(d(p(((l(h&(,3$(i&((BT(((4B B(((!L( B(i&((H(@(0D&(i&pi&i&= 0/(0/(0 /(0/( 0  /( P0-@L'PD@00S S cR 00C((0P /( 0-LM0/0@00 .P KP g0: Sl  S` PK0KP0 : S# KPP(H6 2/C -`x0LMP@`P0K#@^@0@808@0p00z"p0K#K(((( Px0-L'`00ST00S 8 0C 0BS(0  0   ((((// -LHMU*4K⧠TK4L@Kp0DPK,<`K(,` PT0K B$Ki&EC 00S/( -L@`p}PUV gL" 00'Pd(( -LM0 QpI R%pP@0`S:S70E4 N  04S0 Q4   9 X/R/  0a Q@` R:R 0:R ` `"4 0C(Ko"S P8 4 4#8 (Kth&|h&( -L M@Pp/ `P* 0 qT@T0 "T# "`VZ0S 0 ^A0S =0S 9@" KoP@<> DR~  P 0  ((} -LM @P`Rm8p1$K0p00( ?["pWZU l#A @ Q T@P@Q<A 04AS 00CS00 @ 0* 00CS00 q@ 0 $KQ @@U P000KK00CS0P00S ^@@K@4,~(bCzCC<i&C((CCC -`@HPLpP 0S%SP @= -`@@PLpP 0RP@=- H0H1S RQ QP 0h&( 0-pP` 刀 L |@@ 0S0 S0S00ߌPP|U00CS0$Kk8@(h&( -pP@0` L 0S S:Q `:SQ`u00Q %Q00S  $PPP0W :S@  <@/P R00SP('Ch& 0-`@ 儀 L p 0Sp00KrPU`|V00CS000S$Kkg((( 0-pPSL R.>0AaT'oWQ p0001 0 @0 0 _00CS0L00S .<0`P `@(((( 0-P(@L@P0 0P0= 0-D@L000400 00CS00K0hW(( -LMP/`@0 P @@@o K}|P00š0 &0S "0S 000Z300P@ P @\P R R R     ,Q R 0 #"  " /R0  QpP=Z0 R"000  KpPZ w 2 @# 0h>00(K H2Q  0S/R30SZ U#P pP 1 @ RؠK R ؠK pV1g#P R  R K{P * RF01 R$ @ 1@D7 P R  9 0  00 @ RؠK R ؠK   BR D R T(Ch&i&P(C(C|h&C( -PLM@p`t2@0 Z&P@0Z 000@@2 p`Z@0 n)2 1S*Z(KbIY  `p@PQ4t|T QQ D @0 D @00VXWT U0 08K0 eU 3[s  P }>V 0SX@0@0 Y  P 0S`WCH(h&(( -x@L0`000PS SI000 00 00000CS0Khg( 0-LMl@ 0P0002KP0>01K0I K 00CS000S K0(h&( -LxP 0SOI -pL$MP@`ሃY%P0cS   \pPp vP@ VP`` ,( R\cS# T<0S@0 P@0 W+P 03K000 3[S񟗌  , QPTf\<&TP H< RP% 0<P<U 00S R00CS00 B< 0 0P U (K<P/#P!00W@0 t1 ,0K# H0 D @00S@0 H0ZT1Z<D<yPT<T~`T啊T T TTC<`~0 8K`@000 DD"DH(jCED4ZDoD}Di&D(CDDDDD - L$MbR@Kp~0@+0@T T T*/T :T< T-@K (KT$T*AZ  0000S(T:@`PKxyP` `@KVp~ ZT  BR @å0H H0@ R  yW 0 BR  R  BR   BR   |h&p(4(h&(: -@AL0PS,1 `RqP0S`P00000CS00S  0Q" U R`p00P UP 0000000CS00S R00\(`((( p-L M0@!SP 1Kp*S@S``00P Q0C RP00C S  ` KU@0S 00S=STT00 D0 T 0AD1U 0 0S 0Sph&L(d( -h@L0pS`P  R R00` P\(`( -LM,s,S0`K0 00 0 003 0 "@K @ 0 DKLK@`Ÿ2  1 0倢0  BR 0Si00CS0D20S , KYvPo0S 0Y00PIؐ 0KX- X`* V. R@ DRA/@`F0 SR t! BR  R @ B ~  D @ B D 0 B `F BR ĥ@ R @ V Rd@PvP P `00S 0DC0@00CS0400S (K|h&(`(\(p(h&T(4((:( -L M10S0(K@p1 1000 ``00V :YW0S @Px00SFQP p0W) Sp>40 40S@, @0040 40S0S$ SPP`0'P "P@P040 P 40TDoPQ0 @P@p`\(l(i&`(NS -`P`@LPP00`000`0CS000S `((\(( 0-LP\@YW0@ 0t( -QLMp `0P 0S*00G@P `K)PP `R@ K P0P@@0`SP0S0 0-@LDMP0 X0 `[Xo *XI ?X; XZ 0S0S@0S X0S (KX \X Z0 S@0S@#0HS Z0 S@ 0R R@`Z0 S@ 0Z0 S@0 S @0*SS x SR?S[S R S0S P@ X` 0Z R R @@0^S!S  00x \Q ]QR0d  d0 R 0B?oZ20S0`0 `@ `0p0T0 0x RW~  [W\  :RD\h0 \0PPPh0:PU*\WWP \Pp -R_0]Qp \QQ0 PT0@KH0 0HKh D0 @p <0 \0 商P T0h H0 \0@KHKD0 @ <0 剆P 0]RRd  R` `@a' R\  PQ  @K U, K\P*@Kh0 rPh0 Th0Q U  ,K\5 2T0WPP00S P0X`0P0 @R<TWp_D 8 -LMP@ 0?S*SL [SA0^S!S00x \5]P> [P+:P*]PP/P^ P 0S/S 0:S0:P0]S 0/SS 0/SR6@P0P/P 0S xPS@ R0$Bx RP 0S 0\(KKtPX;P 0U0/S 00EFP 0S/00E0S``0`@ xQP 00 10S" V/00D0x RP000Q:0 p R /  70 pP 0.Bo.SQ 0 0 P V 00WX(1 D( @-00 S 0 @^C\B@x R ^ @ ^0  -@QLT0S0@@@?S*S  [S00S `0p000S P s0000CS0P00S 0S Y0S t((X(( 0-@$PLT00@@@t(A- 00 S@QA0 p`^   S. RxPPU!^  ^p0 ^S PS =^^ TR pS @0C  8 0-PL M $`KG0fCK ゃ0F #@FP Tp X-00D@FL`@DPU$K`00CS0PP4( -L M R@@0P*Sp #S $S !Sx8 ?S @S. -S\8PpTP8PH(K884808@A0S (h00CS00  PW0000Q00S 7w `R'0S00 0|S00\W0CS00 w 00CS00 v 0S 'V00CS0s0 l00w00f00v00 000S 0V 0CS 00CS030 ~ 00CS0/0 000 0 V000S 00 S 00CS0!0 ~ 00CS00 000 0 00~0000 0  00 00~0000 0  000000^5 0 50P40S00 " WZdm 0  R!0S U~ Z|d判 40 0CS 00CS0j0 ~ 00C0St0 P 4d BR  BR  ~  BR 0 0  ~ 0 0  00 S 00CS00~00CS00000 0000So00~00i000 00`00~00A RWf0Sc x"db00C0SL00PW00C S{0 00KNP 0So000S=SjU20 e1 Ra0QE100 00WppW" aQ000SO 0xA 0CS 00CS040 ~ 00CS000 000 0 QA000S, 00 S 00CS0!0 ~ 00CS00 000 0 00~0000 0  0000~0000 0  00ph&L4P40(p((L(h&4(:(l(i&d( -L4M0 @0 6p04 = 6 88 `H0 @ 600F: P Z  #PP00@S <6 0 70P P " R PP 0&U%  A0 %~ R *R@R   " X R H R F APXU PD ) Z= T740  PpAQ!W@DTZ JJ X6$00C@0C0$000D0S240@@@9L0 < L0W<  @|$h4 X BQ@ @CR<@ <($<0@T<0 S0 S$ <0@T<0 0@S30S@@40@040 0H S/`.X.//....0.3 AQ AQT~AQ(@P L L~P P L LP @D P @P~@P@P L P ~LP L }P L@|rPT?0e_oRUV40}800SN PX(KUE !A00CS0)0 tp0 pG@0000P  00BpC0 ,!p0pp0u1D 000A'0000U 00 qP 0Y~PTR ` R0 R` R` B\U   R0S 8((p(|h&h&D4(L(:T( - L$M< 0p % % 0 D$8 @@ ~Q {0 Pd崤4 QLQ*=Q "Q :Q Q00000CS00  0 P 800 AA P0Q (Q< R   R  BR ~ 00CS00 RNQ Q QY  R(KQ1 L:Q00CS0?0  R  R @R0=S P2P P 00CS00 w 100w00  00CS00 u 00000u0000 00y10S 8 0 @ CR SR0C0g Ye 00CS00 v PY00v00D0  ~ D0 dD D 00 h &<1 D0 D0 0  BR  " 0~S=Q40S 040 `H0 D @ DH0D D004l(i&p(|h&4(l((T( -pP`1倁^0|Sx1Pp l1lA 0 0\1L00L1pD1 p<1 V0 Sh000`0`0CS0!0 p0@@Bp@ 5 0 @ z 0 R 0800p?0ph&|h&p((T(4(th&`(\(l(t( 800-4PL@! K0hE/h&|h& -L,M\A\q0H@Q00CS0@0``1~@K'0@0<K@KW 0 0C 0S0$K /0` R"Z 0C 0`F`F000`C`(K00000p(|h&4(l( -LM,Q80 (q0R00 0A40 0`0Q< <00040P080ZP Z 2 0 E0CP0(K0S P LR/0< F40A0, h&T(4(p(|h&i&j E<(E -LM c80 s000 040 000BSP0B0SJ̢Q< )<00040080Yp> Yf Y`0*0`HV(: 000 P00W BUW#*VQ  000 PD偐IoU㩒Y`00`V:(KPQ: F``HV: P6FUW * VR P  R:F` PU R``V:`pH F  0B0C 0pGHV00 `F  B BR  0 B0 0 h&T(4(p(|h& -pLM8K`P 0@ 0嘀00000py00CS00 p0@D ,@8K$KJ00p|h&T(p(4(th&\( -L`p@1.A00CS00 - 0 P U.00CS00 - 0 P UzP-00CS00 m- 0P}i&wq -L-E -L-E00S/ R h&T0QH0 0Scq o/P0//( h& 000 00C0/(|( -@帀0P000` LRp$ x0 t 0U0d0P p T 0 0C `  S0(00S$Kk ( h&|(((( 0-`P @0p0WL0 P 0X S S0 000 00 0 p0$`  d0 \0 00T y00CS0,00S$Kk h&(`i&|(((( -XBLpPR 0 Qcr 0S ((,$, 0bSA0@@0/hP3b000r0Sh00CS0!00S 0Z #R  h P   hP$, 0 00@0 P   PDR@ S @  BR 00D0CS0000P0`00S ,L0 ,P0 Q( h&pi&(i&|(OEh&i& 0-X@L00CS0@ 00Lp000CS0K0hB(|( d 0-`@ 0L P 8  D    @ 00000 0$000( h&(|( -pP`L000$ hU @0Pڭ$P0pS  0L 0H 00000CS0(00SKh(@ h&((( -LM0ap00P0g@P K[iP(0: S$0 0 KgP KҢPg0 000 gd$TgL00CS0,00S ZK(lEzEEEE( 0-` Q LP @ @T0P-H0D0@0`00CS0(00SKh.(|((( h&( -@0P  PL `#P x 0S00x0d X 0L 000CS0000SKh h&(((|((0/ h& -P0`0@L0SSU h&(E 0-P@L0S0 h&( 0-PPL0 @0P0ء#0P0 h& 0 R/(h&A-@ 0@1 ^P U `pWQ Q 00q A#^  r B.PU 䀃0(5rO(h& - bL0pS 20SPAT p H#fpPPPU* 1F fp "#!JxQPf0P 㫧&&&f(1PP gpqx  Ip,ex >f0PP fpTx IpJx "00`&]&Z&p(4((h&1Eh&4K(0(F7F -0LSP`Ѐp@0000W <p 0WVPxV0S `p` l0S *00CS0P00S$Kk pGo PQ`(_F( 0-@h0 P L P v@00CS0000S0K0hu(( -LTM@pP 0 )(KؐY PY   0SPs  0 S S S PQ 00S00S@0S22 G! 0R+  ~  !R -  "lK)lK` l0Kt"0 ) `0l KsUD Il0K`lK*) 00CS0(0` V )k p0S 00CS0(0 00CS0(0 | 00CS0(0 0p0Yp0 Z(000t!lK1) #40  ')  ")P S#40w  0 }l0K`@ fx  (p0`0Csp0 0㓉(0H`0((h&5rOxFFFFFFF0@-0  R#R0 B  0P\.^0\Q #40 Bo4SQ#400000@ -L MPPp2@ 0%S^ ~ P T @@T$1 R 04!0@S (K0S  R+S -S %S d1@0@XZT08W0@1p>  ! #@0S 0S 0?R0  00 徼P00 T0$@` P! P  d0 @  RJ0S ^#0S 0@(h&FF(FF -(AL$40SaP0^0pS0@  'А㼠0Sʰ00CS00 e' 0 (0 R  0 S #'(H(FF5rO!GFi& -p@`QLP00S|x10P 0S \ajPp pP@ gP`WP 1 Q@1'@V Q@T, 0SJ '0 x'`00CS0 &0S 0 0 00S0 S 0 0`$p*G.GH(VG(5rOtGZi& <00-@LT $P0@@d0(F8 P 0S/AQ //( -RL0pS P`VQZ0000SnZaP000K:@0 4(00ST0Q0C  S0`10S D1 P ,.0! Q0001 0 0WЀ000CS000S Z0S @@0 0 0 Z;sꔂ! P00A R 耈(((h&( -`!@S1p@!LP OR$Td1@WV2 T1F0S. U 0S0PcPbV 1EpDt \"Y"060S$ R"O"L"VF$C$U 0S  PPbPbP @@WT ,0 4((8((h&(h&7FlE(0< F R Q  R  P lh& -R0pLMtB00 K p` 0S0S (KPP " 0002@" #T):U 0S0 10S  160S   UIG RG E1p!00CS0p10S M0S  02  8 08\R Q 0S Q  {@|. \ ~ Lo ^ \ P  P 000 PPX@~  Lo ^ \0(((4(h&i&( -LpG@ BP 1F0St @DPbU @bDpYs `P@0S0S 0S0S `@Y 0 Z  3Z 0 00h&(h&I7F( -P@L# P06 R0S@P|@|`00S 0pC 0 0 SlPPPwLh&H(i& -@L$Mcs PPT  &P )P qnU pUT pi@\`H V XD300SpN pLH H0#0pPZPY R V p0D0 H0 Q8ZPD ?X ^ 0 L PPL  0S00X 0STp ' 260SK(K0DP 0`0^  ^ D D/o"? TY q'^ Q D VQ, K"pt"pD R RL *L RQ ԐToQp 0S 0Ct 0@KU p@KD RXVV `V SXppOGD(GG{G(H(h&} -L@_`\Q000 R 0S 81Cp q!k0S 0 00D  S x Bo00P0R ` R\ `` R0 (0Sw00CS0000S ((h&7F(5rO( t1-PLUd0@SH@X#`p00S'$a00CS00 " 0 #$`p0Sږ Bp 0SGq #%#`PpP000E0@0CS0<00S (FF<Fi&(h&7F(( -L 00 KhH( 0-@L K0h} 0-pPL P0S0 0Q0P @T "0 00 0(GG- 0h"0d2P @XrXXXT0S  T"0@D0P0@0PЍSQ =S^ $Sp 'Sn "Sl 9S \SSF S"0!- $0!*0! S$0$S< 8:S 0S   R  000C S0,0S0!"0  @T0 R 0 R00 0  }0)0 !"0\ 0 a 1 }SP 0 :0 0b\0 ((0h&GGGGGGGHOڋ -LM@PcPsTY 0SV0Splrppp Pg Pd Pa P^ P[ PX @/(}H\QRHHHHHBڋ!H%H-H5HAHy:HJGHFQHUHMHZHHHQ H HzeH3 -@PD`LTUHU 0S ?@~ -x0`t `6LPP@F0S@2@Hp@0S. @D0   0 (h&( -P0L0@S`p R 0F0S P 0S0(]WX0HPT P000V0 4(h&(h& -LP`pȳp@ P 0 KhknE0 kH -P 0LMQ00S @K1ԁ 100 000 0S K|pPK@(K0SH  0 Q S/R CKw]P 0%K%KaP000Y0S)  Rp 0CP:PZp"00SPp@ p00CS00  0 %K @ 0 SH0 p{0 0(((,(<((|Hth&4(Hi&|h& -LMLap8K5@P810S 6W0@?o20S 1tQ;0V0 0P!1T00W0SV0SP60S .0S @8KP P8K0 KP VX8 0@0C?o20rh&(i&i&`i&H( -0LS@000O[PP000CS000S U𨝸@PU` `PV0`0U0P0p0S V00U00Kh((h& 0-t@L00P0[P 00CS0 JK0h00S (lE( 0-LP@DPU&0 -L-iPH -LjPH 0-L@I?0 -@0`SLP~Vp~0000  00p0CS0h00S r0p00000`C0`0CS000S _th&(( P-L (pZc 00C00Hth&40  0 000 00  /th&4(8( 0-@` xP L 0S0 000H0 00CS0000SKh00 k(th&4(( 0-L@ 0L0080 00CS0000S0K0h(8(( -$a$A0000I?o!2W0SPkPLP, 00.0 000E0000PS W 00CS0t00S$Kk E P 0 0PP(th&8(4(8((T 000@0A00CS0/00S/(th&( -TPL@ H`P T @D*@00C0C0th&4( -,P,`@L@Dn00C0th&4(( A00C 00 0C0/th&4( -@L$MdSdc8@ PT qP 03p0S XpY0@80 !0P0`P"B<0 @ D  -KFYPg- [R \R80S -K8YPY-[ Q  BR ʥv- [ RJ <H ׼PH  @ѼPH pUPP!`mUV AQ ʥN- [ PVA`QP ʥX?- [ PQ  H 40H00 a D0 PU    PPJ@ T  G @P (K0<80 pP 80jV00P0S0J ) UP VW AQp PHD(H(HNSth&|h&4(<( -LMptB`P[d000YPY00CS0820S D(20@TKWE  r0@00Kw $0K0 C@@x $0K0 C@$0K@0  0Dr0,0K0w$ K B0x$ K B0$ K0  Cr0`(0Kw $0K0 C`x $0K0 C`$0K`0, K0F0K(0Kp$Kph0 000 000C R a0SX000e|`P |Ph00CS0@00S V@ Lj $((H(II|&I/I -LMf@P`r8Pr0S 0S20XUs @Pr儢0SF(KSP` aPP HP@`pU0S ($PL 0 @$K/\ 9\D00L@0 #?$K\ @0D 2"0D BP<KXp,ipp<K X CK0 W  UT4pCK ?M@ 0P@Q@PX0 CKSCK<KWP]iS CK1 UThxtCK ? 08kg0IIH3H(\3vIYIlISII3II BR00/0S0/@0S/ R / -L M0 0 0@00C S K 0SS 0S 0 apWV KШ0JJ000C S0S//Q0@-D0 \ @P U@R00h& 0-@L6_FK0hh& -@PL` R\Q4 aq!1R0 0 @TA00CS00 F 0 @aq Q 0 pR  @TP(aHq@P0 R R$ @T@00CS00  0 Q uP @1@nT``pQ bPKh\pW0 8h&HJJ`Ji&ISgJqJJJxJJ 0 @-L\ Kh70S 0 h&JJ 0-0LS@P@D0PK0hff -@`L1Sp@DPU 8@P0`0 P`L( -PPpa ph1L  0S-\#\= -\0S= @P U00cP00S$oP 0S U+\ 0P U00U `0`tc@U<0PPU0S,Ko|H(`((JJh& P-Q00`0AL 0S 00S10S006X pW BP >P6p60S0S60F0S60F0$1 0QSCSCS 0p @R Q  `0  2000S 0S R  R0 0`0  @T \$Kk*H(h&`(d((JL( P-L PP@0S`0C p 0XZ0_Q0C R 0 0CS0D00S {0S #0keJL(J(( P0- L0K0h\@000D00S 00CS000S I0(H(( -0L00C S R3P 0 L( -LMpQ` 0S5 R 0S @0?P0CpC10@" 8K,8K8PKP@ 8K 7PK0m PPW-Q\   -R0S 0 PU0:SI0Q@4T3P:U'8 K8K 7@K@ U0:S 8 K8K 7PK@?Pp0p'1@:^0 0t#Z00  P@00CC10p 4 }@p(K}(KJJi&K -PLMD@0P  Q 000C? K/KL(\( 0- LR0 QQ0 -R@ T -PQ P0:S0S\ 0\ DP8\@:T0000@(H(eKRKD( -\@L`080SuP@ 00CS0P0P 800C80`i&4(  0-RL0@T c0  B 0 0-@L0S0@ 0-PL0S@0ڈ/0@0 0B2 ! ! !!  !!0 0-@L1    @0`i&0S/x RS 00 S/00 00 0S/00/ 808 00 0=S/S 00/ 8 0-0 L0`i&$L -`R`L@PP  0-S0S0 0V 00080@9L`i& -LMR04 8 00 'p@0S |xx"tp< 40S5t 5R@<  BR  @ɥ @<0@B20@00@(K  B Rɥ@ @ Ta  p@@ T T`p T+R) p Q P Pp P  Q R P   @ @ G`p 80 BS \TR @ɥ4@ P@  BR ɥ&@  p@_$h&d4th&|h&4(`i& -L@M0P0` R@z0 Pl l "LKLKqL0KVL 0U<0< 1 0LK01 0 `i&GL_LLd4LzL -P@LM0K0 ; 0`0S@Pp@T*wp`T @TDaPL` @0 "`0K+K@th&|h&(LL |00-0L0S d0P@U U L0UH0@0P 00P0 0 0`i&(L($h&@( 0-L KhL( 0-l@lPL\P0 P 00008  P8  K0h$h&`i& -8RL0@T @ 9 0S 0 @ 0q8 쁟0 葟00CS00 `#V4  V v v^ $Kk` V' V )V< &V' (V0@@\V3 |V% ;V&P0 @ ;P0 @ 9@0\ Pp10@000 t&P0@ "@0k|P0@ @00@9p P  00P000G 0 `i&$h&|((< - L M pa0P0 U U.`,0S,@0% .`P @  >P@P  \00 gP00@DDAPPU 0 (K`i&4 - QL0$` P O 0R', (@R   R`!PT    Q Y 00000S@0 R@ BR Kh=080@ `i&L -Li0 000`i& -L^P 0-L@VP0 -L @KP P <0 000P ` PPP`i& -L M Q`P0 # p @%P" BQ  R  0 0 @WP'V/ (K10S @W Z @@pY %ܨܨ @  PP    VfH0 RpV k 000`i&d4 -LKM@1 H5@0< 0P! L1 001 (50D1 5H 0KK0D81 әP H01S 0_< 40 D!4 ϙ$000810 Sp48!p0 婼d4K/K `$00CS0 @1S#PAPU4@!0RPPT `+@1SP P| 30S 3cP3 3儓 0 0S } 0 ^`P@D P; \P p+03L00O P0@000  #\0@0 $P <1<021#20#"T0"@ 0AS0\00ťP\0P0"00CS0@ťPP@0000 P"00CS0 0 ť 0 "CPnڎ i@h100@1S 10 A08!SKڐ!堁W@0 8!818!@00C0P000^001 00CS0(10S 1L!0 0D! <1Y`,V`>P0 |P000`$@ 0(K$P0 ,  &0`0 &P00 0=<Po >P9 &P00$h&`i&;th&|h&(|(MNMeM}M+MMMM|&( 84(MU5M<: 90@00 ((0 @ -P 0(0   20Q@,0/{PA@`   } {S D@ A@Y^#P0`" X}P0N  P``= H}P00 ` 0   `0A封. AQɥ&0=AQ@ɥ0 0@Vk%S` :S/ #S0[ 0 ``0C P@AQ@ɥl@V0 0@ Q A006`0 ḬP j 02!R1S `0IS0@`0 `Y`o 0Y2 P !cڤ!!^0 0S [ Fo}S㪢ZP `'S02 4P w000@"0 P!|$00 00C0"000$2  P!Q 1 00C0v00WP@X -@L00S`Đ`0PU ` 0S > 0 0   B/o"h0p 0S 0   0 0 0`i&; 0-L^M1 0! l1 p "1t 0< x1 10K|1 1EK01 0h1 PI@1E/K 1Q!@p>K0 dN 0S Q. 4QG hQ d \! h!X1 0` T! h!YK00h1 !0 0x! t0l! 0|! h1p!S0h1 hK0ph !p0 `0x! tH0l! D0|! H00Sl園S,0w 0(h&(`i&;|h&(N -L M F,`K0 00&B P" 000;P1@0$00`aPP 0 R 0p     0P0S 0 00| P0, RePp 000P0 0Z0 R, RSP1 [00300 0000    BR   00p P 400000CS  0 P Pp $4pKpDx! 0 0008 P0C 0 00p0 SpP \V0 R   L000p0SA0 R Ӻ004 3P 0 R000 0  !P 0@S P 000 pPp0P00p P0 0000000S$ U 0S 0(P000Po|00SP00S 0000P(K0$00``i&3NJ4 di&h& -Q@LMQ$`Kp0 0pK@&0 P0 0X@` 0NP R$@@pR(" V0 R`00 4 R/嫩pP =0 08 00C0)04p$K Q  00S PPP0( 00 000 @P 0`i&$h&IN  -P`@0L JP0 000@AP 0000p@@@,Pp 00@ U000 00@0SU P`i&h&[N 0-@PP0L;0 @P P 00000S0 T00`i&nN P/0S/ -@L `Pb00`P p-L M@$K'FP+0S 0` P P  AE$KpP `P$5E㬪㩪ᦪ㣪 㠪0S 0  F  &B 0/((RQ%WEE -LMrP0 U00000@0CS񟗌0` D@PV D DUL20S| T |X`,",D@P 2N0S' `Dp@! K0FpPD밹P 1 嫹 `0: SD띹00`\!l`L!` P P U0S00  uP @~V 0VzD00CS000S !$K@. ]D@0@\嵻  xT  BPK`MDV 0!(h& (O JO(0nO P-LP@ 1D P %`'DcV DO -Pp@\`LT@Q00C0W PDT@(( -`@``0P0L000T00CS000SKh蒺((( -`L0L@TVP @PCPU( 0-@h0L R 0C T DCP C~ P 00@li&(( -PL0@ S C`PT C艸0S 0 S zC`{0S (( 0-PL @tP00  0( H00-@LP  Q TK0hZC0(00S  R/( -L@PP Q0 /Cp`U -nU "CpU !bU 005OOOp -LPp`p@V`   0ẀPȐȠ 0S WT  ,Ko    0@  W  T0S@@ PW i&Dh5LP -PPL` 0R Bp@ / Bp@  Bp@ Bp@ Bp@,pP03/B@((P -LMpP 08 K0S*070K0@0  x0`01 쁟U70[S!1 60[S1! (K`1@ R@00CS 0S  BBPQCT L@0S> P90$000 Sl %Bp% R R R ^T U BP  BP 00CS0\00S T< 8K000 P((i&i&i&(O((O( -P0@#cLMs< 4P 0P 00 <g.p 0U80 @D:TR] ;sP vP 圸UP0+S -S 4K0`K P0TrQ D<偸0K4`K S,: @0 P@0%  000&PT <08 `V ep`00S0SPt p0 U@0S(KU= 40`p0      r % 5S =Ap>S 80 /Ap80/pS dX0  T00 0D&rP0(FP\5PwPPPP -PQL@T 00CSPDa10SK R 0p0CS00 p01L00<S0S  0aL00CS$>S0Sp R 00CS0f0 - \5} Q 0-@L⩵TP0 R  R 00S 01S0 $ I뒵P00S|0!R ! RT  1@DOoT!0B00@060S@T 00S0 (0((((h& 0-@PL cP00 k6 00}4(OQ Q-L@ 00CS00 Pt`tp X?U UP@U00CS00 < 0-Pp @ L l0S 00S Pp@T: 80 00CS0 00SKh诶(0(((L0P @0,Q Q0S:///(0( -LM02@0pS21S 0SPP20S WUT: T T5 P PT T1F0SPPTP 16 R'! R#0SPPdaQ4 K p 40S(!FQ DTQ56 R2K060SPPPQ0 Q U0 U0 U0p WPUb0@D>T40 00 ,0 (0 ^00 4K6?2 K1 @D@(0(4(h&`(( P-Lp@4`\OPPL:H44BPP#@ d t1S 000OT ;00CS030S Ƶ@@T 3 P6`P@PPGU@ t `P]PEU@YX @4SDs 0F0 1ST$x@ T@`@VT @rP`1S 10STW@ T|@P@UT \@XRXr1S 10S |7@@TPdX10S oP `@DP㜑$`0-S0S`U@GP Y?ZX# \q01 !Rk 4pW+$PP JaP1 oP ' 0J000V0S0V00 S`hp 1S NZ a  P00CS0(00S ۴=OQi&\Q(0(((_ TQ^QiQI rQ . i&Q -`P 0@PL pD0S 00S Fo0D0@000CS0<00S ,0@T:VKh(4(((0( -D@L0PS`00CS𨝘LV00(00P,00SP/0S//0(( -`LM@p1Ȑ010!Q0@S10C1(KaQ< !R8 4K2廾8 TP<8 a806N뫾P 40S 4K⮾0((((@ 0P/!!R /0( 0-<@L2PS0}R00( -0LJM01 1"R !R "R0! 0! 1 1"1"1 10S CKڇPl1C/K yCK҇P P!CK000ʇ@P,1C/K /\0AT0>0C/K 0PU`@T 0S P޶00CS0 KK =w01 1 1 1 0D>S 00GK <j><" K!0310((((((  0-L"t0( T0-LP^'@_P0 @P?T006 d00-`P  PL @ VM0 0000CS0000S0K0hN(pi&( -p@PL`U \<PPEUp` VDw0S 0-QL@0 Q0P0 BP1Ա01ı 00000 1-sL@ 000010100C0 RP000D0 000CS0h00S sDP`00030 0C0((( 0-@LP@0SL00S0K0h00CS00  pi&0pi&0pi& -L M@K0PƲLKQ --L M  K --LM0  Kpi& -0- LMp0 ( $ @P(K0 , $00CS$0 (KU(0 ( 1[0@0DK0 -L@'P8P$ 0S! p©0S00CS0/0 "  h00CS0 0 " 0S pW `Pp 00CS00p ' `' 0'X0C! S00 XV 00CS00 ' 10S$KkV S00 00CS00 \ 00CS00W ` `V 9`P 00CS00 %R6pi&0Opi& 0-@LyK0hupi& -0rSL*RJR 0-`0 @L0R.0pP0=00d=`H@X@`@DS0ԥ0ťP0P0 0=RR0CX0Sť @$KkR|h&4(th& -L M D00 4@ 0C00 0 00Kl(P(oR0@-P 0S SR 0T 00@PU U 00R0C000 8 0-L pAT0'Sk`QU @'TP@Q  0S 0S   3/P `P00( -0LS@KhCEPᷪU x`xp0S'S3P@'៝PP8Kh& E"fQwRRR) < -P0LS`p@    3/@PP@X W p0@=SPP00 00CS00 [ 0 00CS00 J 0 T ?i& M -L MA0Sp 00`P 01S `'V0 @PU*(KX   R Q ʁ4 00 r4 001P00 eP(( @0S =0C?oP2/=S/ -P`L0S=SRPEP'K`0VqApT 0S  (tPVpPp@( -LM1P0@S @ K$KpPU   `I J `ԯ  `BKhI @0\0/ -@PL`4 0P  S'p&&D&p&p&p&p&p&&p&p&T&h&&&&&&&&&&&&&&&&00  000@0N  0 000 00 2  0 000 > 0-LMPP@ 0$0 0$K 0 0$ 0 0 $0@0K0 sK0 -LMP` @KUP K00000pZP@P000/ P/00S 0/w@P/t@ 000/t( 0P00/t(0 0(Ui& -LM@PaTp`@5 7T0TJ*"T. 'T, T RTߦ L1` \@ ETJ \T R Ц 1 nT @ eT9 fT @ bT@tT @ rT @@KvT @ xT0$PKS$0K0 #0K0 K"0K.@ @`0 S#0K0 K"0K0$K$@K!0K 0# K0C@`@Ut(V -L M@P`$qP \P 5/@ 0cR 0< 0 K0R@ "! "7Q 0A T05/@MR0-S@5/^S0  %KH@%[^R@0?S0|&t( -Lpᄟ@@T@'@8P`D j0`00@04Vt( -@pPLP0` VP  V @00CS00 U 0@P000CS00 C 0`t(i& 0- LR@ Q@<֥ 40 0腣"P0@ ɥJVeVt(} p-L Mh 0@T 00Pj P K<` V᧥Kpt(V -LMx 0PU 00 'R"R@@` C @ Kᴝ`p K`pt( 0-gL,MPP@ 0%忑P'p70PEAU]PE@0 D <0 0DP`@V  7< R R y\V 0KG6@00CS00 6 00 [ P%V0%S@600CS00 tT6 0`<\0`*S080 E`800.S80@0*S80080 7@80Z;080 `4080 @80cZ0H0 80 GZ EZ*AZ BZ; %Z NVBT(KaZ XZ iZ dZ gZt0Q 'R"R 00Qv t  sZ oZuZ xZ8tTP =w;P T \^\ s080v t 0 R \= , \@ \5 \b 0p00 M0 0p\?00 \-0@Ǖ0Dž \ \v0"\  \ \e '\ \\ afnrt넂@ XP =\X P = t@\0L0 :Pp\ L0x uL08 s0v0 t p0 pp AX0@ P0lP0 t0  `0 R00 [80H @ 1    Jt v t   0t 0Z00K\0 0  0qt 0i8n&t(D&i&VVV|&4(($,<V? -LM0$PK\ %p` 0 D @P 0 ( @PB 0 pW( PuY <YPP0' 0ES4K  P  Ð400S00H lٴ^YPH0?S0 -S00H0,$K6VW\6\<\D\p\\ P-L gg\ ] p-L M0@0 0 \"XPX` PQ |Pw ,Kph"00 "]VI]P] -LM`8 : P8 0䡟80 80S(K8KPP 0S = P@@0 K spcWprP000 X!5iWLgP000 4`P0 K s00$0lWRP00 0oWHP000 AP@0 Ks00(0 @Q P< ,P<   BR0 K<s 0 0Se]Wi]Vo]Zv]|]0K00M00P0D0 0C0D080;800,0/(<0Q00<008 ,0,,8 8 /@0D 9K<@0(080$00= 0D00<00,0/+$@( R 8 ", 8 <  < D ,-D  , /ɜ -0ML0$ 0d8 K 0-@L40000 0-@L40000 -L M@(0S00 K0 ,0,0K`t -L@d*`Pv#"8 <@HPD\`V\`, 8C*P^*U0,0 0-@L4J80,00 0-@L4>80,00&  8-L  Kh ꇬ (00-SL@ K0hD8 @0<<@00,00 -LM K "+Pf Kt] -L|+P fnt ] -Lo+Peot ] p-LM0`@K0P-S00(0(0@0 @  0| 0P 0( RT  0 0 S40(廲R03/Kpl<W]\ -Pp`@LQ`-VPQᵛP 000 0 `ᨛP-V0 00p 00- PL@0@P ,0T 80$P< D0TP$ <0<P0YYZ[ 0-(@L0PS 00P0p( Q-0L&  BR QMt 0-`   S^0? S00^@ }x(p(<\ -l@LP`U P诙HP4w,to0p(}3< -LM`p@ P U % TTP" MXP GPW APU p PkT X8 T88T 8 T7T 7T 7wT 7nT x7eT@ X7@\T  87 ST  7 JTUU@BT 69T 60T 6'T |6T  \6 PH T<p g eSo @qvZ~  Y X W0S PT0pS X W P`T;S < S S4 05 Ty W   T`lt P@Td(K.$ 0 T0S|Tp4@TX4TZ<8~T|,4 wTwY pTrXiTmdTj0S\Te3UT`3NT[3GWDT_Xlh=TZ\36TUW@</TP0W)TLW#I SL S  SLJ2  TIWTD2 T?2 T:x2T5`2T0H2,0@0 dKK%PTq쁟 0SU! KPKNT   WQ K  00P~0K   UK1K/P pP0 P[U$UDW__```n^v^|^^^^^^^^^^^^^^^%`,`[_3`B^_:`A`V_^__ _____%_$_,_+_4_=_<_D_K_S_c_b_i_q_p_x___N^F^J^________J`^ -LG8 QO`(& -LM,0, P 0 0>(m`(&` p-L M@`B000 #S@ KP70S  4?b 00S 0 ,bKp<Ta 0-0LSP0#S,@(09&P 000(m -PRL PKM@ p`p 0R"K0"S0SO 0 RRP 0000@O|& 0-l@L0PS 0S 0SS <<< U   S(廮000P00(rh -@pLM`P p0SD埮;$ K, P 0S  (K@"[0R 0S 偮0n KP P0P P  .KRS V`T:0S  P^4" 02 :/PUP4"02P(6iLiUmii -LM G0S S@ < Kh2S S$ Kh/i<iJjrj 0-PPL000S <K0@S 0@0 0Rj -L M6PD@D D`Dp@ 0S00 ajj(&o -L MTZPL0 Kp@ޙ0"S`Kj(j -L MT<PL0 Kp@0"S`Kk(k -`@pLPQ l`ḖP @ L0   , P   Kha/k(( 0-LMlP@ R\`; H0S p ,}` n`K0(Hk(nkk -LM@`P 0SO00+P$0KP( K/@P%(/Qp$0X P  0K( K$ 0P$  LP,#($0 ( K 0K#P$0 0$0 (0$0K i((k -@L M0T P DR@2@!<#8( 0, $ 0 8 4 #4P! !4S !4S !4S d!4S Hl!P0S p,P!T0S X`qH唐8V (Ko 2S/ aPP2 0  0S Sx 13   0S 3 !  r0 pm`k&a6lll#l*l1lk8lAlJlSl\lelnlBBwll ll -L M(@Q ,Q| 0QlMP(K4QPHCPQ4=80S0 ,0<08S804 <P<+PP<$P1 Q0B"9`㬡8X0apSp R |  <0R P 00< S<P0S;`(Q (Q 0CSP BP a` 0ҫh  R  R * P*a 00 彫00(Y<0lllllmDm(m.nnTnmXmmn -LM@P4$;@P?K@ 0K ᠢ堒@P4$;@P?K SR+ d3dRqOK`f/L2f/00R@1!S(R!R "SS0 r1 @1 20S !a8!#4a4# S$ S ?K  K0 K q Q8 Q@1@a8!#4a4# 0C?o2S ?K \2(4"48#8@! R*0S?K   P0S?K 1S% K ?K   y1S KKK f/ᙏ01Kl l h0K X `(KWEVVEW(((}}n(n(no?o(&( -; M$L@ d*G\0PT0 0S <KS 崪Kh (((_oo -LP@`Pp1S% Pv0 0f0Q p]!R 0R00000, (((o( <0-L@P  zP$K0ha (0-0LS, P( -LwP  ( -@:P {CML MX 00BK IX$ 4P  dP00 0PS` :ἄPD  @00hD 0\SD P/XCnK `F (Dd jD0\P H4 3PH4`FFab X` 90 =KP@4SD$ ֩@42P+|i|@ DY 0S@4x0 D 2P@40  2P@40  2P@40@4 天@ḒPDdVc 0SX_ 0 0=KP 助@`D l8@$1\ -KXiCKP H @4$qP D i P00D=KCP@4S ++RH0  D4l9!dN P 00D=K(P@4L0 (> P 00D=KP@4X0 . P 00D=KP@4P0  P 00D=KP@4T0 tP d P 0 0=KDP@4\0 $P  50D=KP@46  P h50D=KP@46 ב P (50D=KP@46{ rlǑ P 40D=KP@46k b0᷑ P 00D=KP@4p0[ R᧑ P 00D=KP@4t0K B aJ0 S0S  u]440Y !!t%*Y0 `,0HH4 HdD4 S\ E HD 0F "ZP4 ; l XT D  0S D@hp(Kc0 RL$ H \4 ڏ  QP\4>L4ZP\48`#P4`F 2Fa`Lŏ`Dd 0SD4 ᯿0D4 0S P4 `0 S HSL Sh SHc뼂D4S P HYD4@ S 傐`|2ST4D  `2000!0@4  0 0=KP pЧ@@4 S ȧƧ0@4 P4@$ 2 S S SHP4a D4S Pv HD4@ S 7HD4 SeH D4S| PZ HD4@ Ss HD4 SHD4 S(oj iAbdoJC !& p!p+p(Cp(Rpێ((op|ppppppppppq qq:qZq(iDee|&{qq 0-`LQqU V t,@P0d4`!!0V<0 }Pp䔿W.DeqO 00-0LS Kh00i& !0-1LSP@4 0S&P K0hAP00S 1S 1S Y/P01S X `P0@ LP0_ $P0Y((aredArdA!r -010AL M 000 p`:kQ U5 1S P0S 0S 0(0 1S ( KtP/0`B1S P K\ \_PL+P 4UPWEV(fd2rmdCri&q(gdTr 0-@ LP f/K0h( 0 4i&t(md0S/!   -0-PL M P 6P 0S S@@ OP@K0x& 0-<@K0C CqcP BKADPUBK@PBKAã(48TdBK( @vp P B>K0C CHcP BKAT(4(0DT,dBK, @\p P B>K0C C.cP BKA(4,0ScBK0 @Bp P B>K0C CcP BKA(400S\cBK8 @(p P B>K0C CbP BKA4(480$SbBK4 @p P B>K0C CbP BKA(440RbBK< @p P B>K0C CbP BKAT(4<0\R$bBK$@pw P B>K0C CbP BKA (44QaBK$@p] P B>K0C CbP BKAe(44QTaBK$@pC P B>K0C CxbP BKALK(44K0C C^bP BKA1(4P0P`BKT @rPB>K0C CEbP BKA(4T0$KWzg(&iz+zzzzzzz{,{O{o{{{{{|=|`|||||} }?}\} -ML M@@@ 8TK @0p P Pt`V4+<[S,<[`S=,\[`P8apEbWWnF`0E `FK8ġ  @ 0嘃!S0#K1`  @p P) Kh @TP`0! H׉ K @P P0S K@, A3/K @D< G+PD<, 0̂RBKx% AB.KK B @p P" +8[SA,8[`S><,8[`P92a0C" 20< S :K4 A_0!SK AWx5BK|% AB.KK B  @p\ P6 x5< K B A00 QPK A4K0 AP0P0<0PK ADxP0x5< 0R 0K A|K  @SP 0 000S 0`p尀P(V R s  S 00  0`PK AP(Kz}}i&g}+}}%~}P~~~6~~(&x(~ - BR0 R  -PL@- R1!%0  0 >X0 8X0 2X0 p,` J( X, L0 @8 44 (< $$$$P T l0 R`V*\  p㔀\P pWp$Kk}h^ %.@Sh~Ȁڀ"} -LM─@Y`pR a S 8Q ,Z ᰉ  ᫉  l"0@K 080 囉0,   ᔉ  lK0"@ } 0Ka T  R1!` K 0 S` ISM SK S^1 0 088QU Ԉt /<0P+8UQ* 80A0༈ @2<0P+8;Q *+(K0a 0 0S S S0 0 0| 0h  X ( H $.7hS[``Es -PL`p(H @@8SKh!| 0@āԁ 0`( "4`#/ -PL@ "44 0"440 E A((,,004488<$<"44$4"44D4$D4"4$44"4$44"4$44"4P4PTTX\`X\ppQp`pQ(4"4(84"48h0`@PV@P } z0T0E0T0E T4"40E( 0-L@h40Pi080f/ẃWEV 0-@PLP NP8#!00QK0hWEV( <00-0LS@ :080f/㌃(* RP0// -L'P0 H @@<@Xm]h& -PLM@ ] K-P L DK%P ,1O+ K 嚊0p0`S 0"S0 VQPV0  K [0P0S  0"RslNHP `P K\eKL kp0 <NK0U  Kم %=(yd}W -PL M@ P 00 @0 K<CpH$ՄP0K(vdq 0-PLM@ PXP HỄP80 K"0pK0z(wd 0-PLMP 0@ K,pK0(d@w 0-PLM@ `P K\p HuN0KT KK440K0K$K #KK0(zd@ -PLM@ i K9P 0EN(0 K$pἷKӆ({dЀ -LMp`@PQ &N4P @03/$Kk@@ P; =p Npj&(< -LM#(0  }븇(& -0L,MQPp`D0 @0 <0 80 40 00 V'D@K OpM DK~0 P4  <p 00 S 0Z@㬐00S#4_"(K H0 H00SW d4H XH 4000 @0D}0} ? 0-@PLP 1P) 1P/ 8>0P  pM0P 0P) 0PK0hƲ 0K0hQ@hK0h!_U@@孲'P0tcidyararbmngnts4< ; 3<L P0@-@ 3@5C!14!8!<@P0")p@-π@Q BaVp(a  …?@@  \P\ @0`0 P#3pa  …?@ P@ @ @D P H ̄ @(L0 R !R "R3S////T( -PX0Lb2pᾂ@Ẃ, T @@DA??@@@( ?00-@@L204 20P0200P20(> 0R// -PLbB0 p π Hz@`T W 20CS20CS  ,Ko0( p-L MP`< K 0@SKp 00S+0"S1Ds@ -L M!@ᾀ00 0 0 ŏ(& -LM쐟0PpL@?!,"K(0 d0(0 0bK`0 0|0 QP  0 R$KkL 0SbK @D`,l} $K0k&5( -@P00L``pph!14P S ?oD 2"R0S 0 團B@|KU(i -QLM0P@/K`p؀~pPz K\ K}0 2 }JP \ %t02S 0S "`  H !SR K0PB@(ɒ 0-<@L0PS( 0 10")( -LTM$K0#80 0H0 30@Pc< L0 H0S< r203 0pK XJ$K ? %KQJ ?KtK 0 m$K  0d%K<cr"dP J$K< ! Q0p s 0 R00 $R0 S p2000#1-R0" 0K090p@P0|P8000S CP  =P  7P* 0p9000 0 SA >02L pi5$;%@PD1I  #0|"0 ~@P|2CP080PB80 2@P80 2@TP80 2@TPp0p T000P 00S  0t  0DK(KAF(0k& (x&>j|&NS^Zae -LM@RK0P0 (JR@ <0 8 #KR08 <0DD B $Kg, ംU 0X !U !@#$sO(@, "!"",!0 00     " 0  0 0 04 8 < 0@000(K{DpsO@s K{X04 2`B `F&$)4a!ڑ&(1&l)8)!a1ݑ")( -p-L M@  00CS0 <P|` Pp pl{I0 P00CS0p<0 Y@oKpx& -LMA~SIP?!l0ep K0#z0 QP(K  R(Ko |  0S#K z0 QP PE ` ,z  0S 0k&( -L M0ㄡ00  0xqP 2S0 K`vPTD!p@8 2S  0`0S"@ R`\EU${p@000 0P 2S0 KBP(K @ᆔ \p@X0` 111 00k&(mdIr͓")) -LM@p2S*n+^   2" E 2"0Kh"2pd֭E"2L"|8Kh(0k&(1Z")$8 00-"LRP  @"n/y0!$!"$!U !U0X@U00 @D 0D܀  D؀ DK0hҀ()( -`@PLpT`s 2Fy  B B$Ie00C0") -LMQ`@P p5 0  ԀLğ R 0*LV$ 21S 0   Z 0 0 $ 0( 0,0 T02SS W=OPß20SQPX & QP 0 2S W SPGW20  0@P@0`A0Q W 32 R R01S 2SxPp(K`b0<0 0 QP  0#KX(ZW 1`WV   B`F RD1aSR148<$d00C0x1@@PAl`d1S 0P0K!14!8!K 0CCp@P,0KD@hBNKd @DU.K B% P%8T5: S"HQP0 00 -PPKA}P4: SpP% S00S BK  @-0Px8PPU BK @y#0P  5 s5P@#)D?#)<N^x -L0KMc0PD@  04   K!K ')³ 0-0LS 3/ 9() 0-Lu0 @( 0 7fu@0D() 0-Lu@h(f%fu@0 -LMp @L`PP0 7/P0 SK gh00x() -ML M9 0`) & 0 & 0 7P=j (K93/0P 9 / K  @"pPK A4O`9P 9% Y0[SU 00 9"[8="[<@0040 i04  0Q P bK H, P7[O  5K+7P 4s `㴑 0R  j `eVXZ  p0Gm  !#;;S`@ `R0 $ R,0T T0,0T0 RCxmD0P20Q 0L0 L R0 r 0#10\0\0P 0Q0h00l0d`Hb· RRaArrAaU,Cc޸p7 -MLMP@00P0`{h00  0Q P KAK+ Al Pp<0#$42K3"K#(#<12K@02"K#$02K/"K#(#<-2K00."KP0Ph00  0Q P (AK A2 P, -L M@ L0 R0!0!0% Rl00l0 rp00p0KRP0R3# rࠃ^ L rH00L 4 0yP000SC  -LMpX0`0P00 ? P00m (K &0 0 0g QP D\ X0 X0 P  -PL,M<0 pPlP00K`8 P P@B P3 0t P` uo0@0 LR0#S!QŸ P\@:p.\F\C\@\= \9P$\ P (Ÿ P? pD  P@PPL0!0@S s@@pP0S'0 <0  0< 0(K^\\\\  L0 Q$ 0 q(@," 8 P p"8 @P*"* 8 P0P S "!"0 8 0P@?aP p 0 p// /ẺC -P`p@LM0 00P0S (KX  H r0A8 B40 40 s-8  r q` & TP0@ q x 0p P 220 P 220 p P s 0pP pP00 Pp<P ź);Nʻ1F00@-S0P^0BPU02 -LpPx`@P  LP 0PR*"0R R 0ꔼ -L M`0pPPPP0S(K† R q  Q R 00Q P@T "Q  PP QA BTS tD q  9 0 TS0000  Q  0 0 g t0P ZP  F BPTR2 Q PE꯼+] -LMpX0`@PPh (K 1m0Wl0L 8 0R00 000 r 000 PP" ` p 0ST Rp rppH 00K/ 1P0 e  L2 Y#t ySl0l#2#>p0 Sll0p Sl0l0P0  ^lp20Bp.20BlpX p!#  K0 d#KQP 0_`  P -@pP`㨑娡LP0S00S <q.`@q8VO"0S 2S 0S 0  0 P0S P  BP`l Q P l0`<0P0Q*l0S 2Sp  l\PP 0 RQ@0P 0갽. p@-XP UࠓࠃPࠣ^p@^`V @T?)) -LM@4 TQ10`p0 TP0S0T 0S (K1 0p0D` # 0 K0 0d#KQP0  00P 0X:0 0#Kc#KQP PLp 00  Z0T 40B()aH -P/t0L%A?k@0Sp pg0FS `C ud@P0U?  C0()0PK %/() -LM P@LOo U`B \p @ ŗ 0C F00XP 5U@T  K V() -LcM@ 1Tp d! `1  SP0`!S@0`pt1 A 1 l1 h1 xA D0" RPX2P 0,,aK ! #1 pHce?K0 aKSR Dh P`P`10C,> p0P0UP=" U|! 嘡 1|!SD00S.  " |1p2|1 00a?K ca?K QP  x (100  RR R0(1`1xQ 1 1 P01 H  h ZP3  (10(1 R5S2堢005ET/  cP05ET \T5d 05 !dP,(K RR6 @ST 5" R %P0S`0d 0 B 0  0c^ JQP d [d0PEd @d0PDh0K/0h0VKf 0! SKk0 r d<0 `1  SK40 8 ^ j  e`1  e80080#40L0s3[050[040040#403[010[0 0@@0 000 D ^ DQP (z()2) +-) $00-LP@ 050()0/-)0/-)0/-) --,@LM  n $|(& -@Leq0 R JP0S 0`V?`  T \4W<@0S 0S@ #A-)=2)w~ --LM  K --LM  K --LM  K --LM    -@L]M^KMa HpH@P(KBK! AEp@P,0KD@hBNKd @DU.K B% P%8T5: S"HQP0 00PPKAP4: SpP% S00S BK  @#0Px'PPU BK @0P  5 s5P@-)D?-)<N^x -L0KMc0PD@  04   K!K 1)³ 0-0LS 3/ @x2) 0-Ld0 @( 0 >Ud@02) 0-Ld@W/U,Ud@0 -pLMnKM `F@P,~ Put=(~ : Sw/x0P  rR d00d K0C P<#@K @($,^ WF(>S T@ KA $N pPVt=: SI^KPE$>"l1$^ @PTPW0 KASR000: EPF,P U $T7@zKKA@aP( vPP@^pP S(^  S$P@p-p$P@ pKA$GP!0#aPU00`q> K0 @K @@P.K B\Pc0S`Y K@aPPxF^K PE E`?PH:P},P gX% (K<D FRF F@ 0`( "4`#/ 0-"44 0"44 04"40 @4"40LPB $0 $((\ XX\ddhhllpptt0 0-"44 0"44LP0@ BB?BCA->C6X3X\0\-9>A9>:>CA?n:>CFA?>CC>A}C>GAmFAEnFAE~GAXJX ` p Q  $$((,S>,A}S>GAmF~AHHLLPPTTXX\\ -L M@Pp ! "44!1"441 $$((,,0044`TQ\50 S L5s`TpԐ}0  $0$S-Y`,\Fh(KTcT`X_X\[\`X`dUdhRhlNlpKptHtxEx@ Z <`9 6 $5 S\50 S` PP%@ PSڲ  4 4  TU 0`( "4`#/0+P0 C@ / p-MLM@R0 ANK4 @D8 PK0C Z 0pH8 aZ@ tZ< [  p6KP L ? O0 0EZ`pK `p ?rO81,%0  08 0>K0C >K0C CK9>K0C@Z2 X`xuP0 c0 C1318 >K┘ 0C R0Z 1'0"(K`p ?&O81,%0P `8 01S !0 8V;>K0C 00 >K0C K 0 LX p 剑''ro0 khɔ da  >K0C K 0 L ᘨP<ᜨ L, l9P:>00 X85   @5 L0 #0S04 K}V00 >K0C0pS KoV 蒟 000 Sc:0 02^e ЁP0嘨 Cpᜨ p c7X0^85   @5 L0 0pSL ACK^) 20S= 0 0 0 1"]K0 PE0 $? <8@(; 08 ( (0(0(0 hh(븈  U  A!0 ؀ k5P0p00@8Q '' 0'PDP>K0C8 7 t0 !8( 0(xPuhx@vh:)>9)88)\k&]9)q}:) -LP@7P0S 70S a WVP7P0S 70S!WVP@P@ -Lp`@ba0 0@$Kk -ML MH@Q  (#0b2PE ? 00 ş 0X 1,%0"xr 04P04 d`PP "`0 R(K020S, 0$ 2r04VQ0n. n  , P 00 0" RP0```00d`Q"R0 PB~K pG @0S10S%4[&$[&4K%$K@p03/`- 0ܠS 00S0S%4[&$[&4K%$K0$[00@ 44 ^@ 44xp *V@d080S 0 0u9)88)p9)t9)9)9)9)P8) -@P`pLAM' @ 0BK6UTp0 SR*BK\'M@3P 00  P(B.K {'K?9)XXE -LM0 K -LXMpP`$X @tKU[0,0KT0fKp0 &KD00P QpQ( ttK$ K(>:)QP-D`WVSRWV\/9) -L$Mp )q QP@PH 0 c04 $? 0 92  BQ ("(0` b80 弡ᴣQ<03<0420S04  X2Q t0004 V 0R  @P/(j  <0 P?40ء  O<0``0  4 V: 800S<00(UT6`5 `0\(K  <0 ?40 <0` 50S  50S 0> p p$550050S 5 ᲀ5000   88)9)9)\k&t9):) -P@LKGM M A K@ X 3Z:4 $5 Ru5&0eSJ 0SE !000SpG|Ɇ=K 0C 0 =K 0C=5000H5 005 H0@4 0<4K5GK4 0 A QpQ8 tK4 A㸄 G>K0C 4 0^% 22Pp|4p(Kl%0S$ D L000 0  HtP $0000S ]0  01PIKA SR W !@ I>K0CC 0 0S >   P2 s%1P `ܒ L000=0 H   00GK<4K2 I4 `}4Iv400(bo40SH_D2BK H00pH0HBK J W#000 S 0000pP%΅G 01J  0+J0  g  0$J3400C04 S p*Pq   4$ 0001 p  s oZ 4000 @ 0$0 K AQP 0x 00S 1XX9):):)\k&Ps:):)=H9)i -L M@P^`(IYp1`V |10S p10S 00 05 P`8(KoL8`@DT= SR1H 0  Pk$P I  0S$00S T K$0S 0S G @(KoX0P H0 (KT8)9)H8):)\k&XX:) 0`( "4`#/ 0-TP@0L8v5 0 0@ 00 20@0 W088)00S 4 /9) 00S/9) 00S/(79)P000 R0-SL4M@P (KL2ЀX0`BXP0b0K80@` R C Ÿ Sß Q 0C0 0 0a@0pἀ ?%KTS #K\5S`9 0 #K ?#KK܄K T0)#K ?R 0;00S  0. @0\5S 0 ?!@PA ?  0#K%KcK 0R 0P00Sw  0H@0 0800 0ih:)88)h9)TBZz -QLMP`p1 SR* 0"Q@ xSRQKQPL ?*H$K̟)#K0 000 \%@1R 00ß0 2",0KK#KKH`䀟 l<, L:0> #K 00S   0 q100x@ğ 0G 1,$0 D00x ?G400,00S(K9)88)2)TH:):) -L,MK @P@KSR3 SR*#K|H"x3K SR$KK\3pppP3` ?G#K_%#@\%P 3R 00ß0 2",0@Px K?G` L< l80>00 <40 #K ?d0 cc C3H0 t2a8b3Q`2`2X2X24$K ?DRD 0H ~/(20Sh 2< p0@0CW40 l10X@(10S<40XDSJT P 0S0?SD?QP 0DQ 0<0 <0Sp@ P +5(5p0<0 "5<0 S0<0 5<0 S@40SʠH 0/ 0 l0x 0S0<00(K@Pp:):):):)88)T;):):):):):)8)7):)9)9)9)2) $1-L⸐`_ 0pF  0D!@PP@P 0`0`0 0S8EH0J@0`0@Sp|HR0 RpQd` 0@P8 !88):)2):):):):):):):);):):)  $00-LP@ 7000:) -L Mp1P`ZW A1KԃK00 B? P PIP 2@8@PU `1 ?/FL1W0VA0 000.a"40 X(010 #a,0 \# X 0 ZX 0 SPp0`Qd0S !Z(00d000 A(K:)88)9)7)7)h7)8)G T00- L?@PE800P 0 W !SR09)7)f -\PL0SL0L@`1F`a0S000y7)7)8) 00 /H:) -MLM`!KA H0@S 0L8 3/ (K`4L8 u0PH8 KP 0C  TE0Q3P0`S( 3Q7Qp<(8,, <0✀K L8 8( 凁O3pW0 0 3. 2R࢟0t0S=r܂H8S;000p Qo   Xt"KT8 3K.PH"T8 R! p t R1-p10QH(6 !08D8H@( 0A?oR20SO 00CK .CKxt+P@]<1@0S- !=K0C  P0: 1 P P8S L83/ 000!=K0C Ps!=K0C  P0k>K!K 0CA  P0!KA H80H8 MDH88)<8):)9)`:)}:) -RMLM0 S000#85@Z@5 & 8`pb$:  P T S$(?V04<V 000R0SQZ !0h0S RnK `F  FKZ RnK `F ,FK0 `B ?DS>K 0CS>K 0C SK R0 A @5R~K 0 pGZ 85-  LT ? a Q2SQ S>KZ0CHp 10w85SX"08#80CK -CK +Pc@50S00U D 2 ` V`80 0@50ST 00`t P?SK A \@5QD 0S.K B("0D xS>K 0C h,0t  #bpS>K 0C SK R0 AX Fy080 01(P KMJX 03/ (K0S.K B("dP3S>K 0CP000H R00S 0 0CK `-CKi*P@5@0S S>K 0C  P0l~ d0 pS>K 0C  P0:)88)9):):) -L M@@a#YP"KR0"K 0# KЫ D J 0-@@LPU DOP P 0 QP009)C-A؃p@W`VX0 0#00 0-P@ L0$3UT01 SR087@%0P0S 0SpoP0SpeW 00S 0S V 0`0S(G<K0h9):):)?9)=  -LMp@`WP 0  P  0p`W) 0S } `RpH0`S 0 0 P0L /p00Sdd, I,00Kh`<=)P 00pKXXa9)$9):)X8)p7):) 0-P@MLh @  6+0AS `wpwxwhwhw00K00\/> -L,M`pD5@ @0`p +0S 0#KcKePp KSR% KSR ؤ0帐 ?Aq`D H DSR/:0 S 0 S PP htK+0PS #K 0#KH0!4D0 0 S:R H0AK30 Pv+P30 \œ#\   s0Ÿ0 0*0|  I0PS`30i Si P0S 3S 40S #+0 00KS0\p ?pA0 " 00C 0 RL3b0*0C0bw428,l20S /@0 : S) S-  S;00000`B*K ` 2@pWK (-0K`K(K0bS 00p10800@0 0X04KK$! T @` `a8b  `p`00S@0C600,P(` @0 ndp4KⲸ4qX  T @` `a8bg ]hX9)9)88)\9)UT9)7)9)U 9)P8):)9)t9) -L|MR2p@ K?Q@0\%2R 0   嘒`0 0 0)0 Gd2吐 0\S0 S Hr0S 3S ,@X KN20 (K'K`QpQ8 tQ4 Xd  K< K R, GXK*00<0[S K 0 0 408 d-@ R 0T 2 K0S0\p ?p?0 " 00 0 @PL3@0@00*)30*0S P@ P)0 P(KSw 0 Vq88)X9)T9)7)9)U :)X8)p7)9)9)P8) -L$M"@P0`40 eZZ8 40 40 l Z0 U0p 40 (K g@_ T DK c8C SBYAQYS T0Z AG0  (08000 @4 J0 $K T0PR#K0J0CK᐀ T0R#K 0J#K R 0#K  #KR 0@$Ka 0  (@ܠ$K I0 L0 0KIpL `R0 0 04p 00800` 00 v(PU@0PԄKZ0PP88):) -LK0C 0Sc ß3 X 0  0SN P`,0Sß9!.0`4 0p0L `N8` ?)$KA0@P P0V20 0\B0S VR@TU B0S JR@TN @|2R@2b@t2@0S pǴTBC~*0<2'020S 0 0B0pS 1 '0,0WO00810S 0S \ 1 0S(K @ @P ,p0 PR<;0S ,6P >K 0CC.P( 00>K 0C 0C(P 0S8)9)88)d9)H8)4W{|9)9)9)h9);9)q:)l7):)L:)9)P8)9):):)\9);)!,DL -x@L`Pvd00S 0S Ljp P0S Kh-9)h9)eo -LM!#KH0@S#K R0SRK pP #K X"TŸ  R0 4020Sa $=wP(KP܃K b<000CSW-0/  1!. 1 R#K0 #K R0  00#K40Q l!H  R0 @  ^P P  004 " #P0*"P 0 &0 S0\ YXYX P{ 2)[9)uL:):)9):)d9)00S 4 /9)00S0`( "4`#/9) 00S/)9) -LM4M8KD0CP$8KD0C@$l(Kp:H BW0( 8K<0C: SWW ` XpP5 D8K(K<0C8 B0 000PP#!0 00(K0 (P X8K(K<0C8 B0 000PPh0S 8KD0C p xl !P 8KD0C40S,D @LB 0; (;(KD B;W1 S> K<ASR:0  R0K<A0 K<ASR:0!K<AQP00*  R00S l:0S_ 8K\ <0C Y 0xK04pG (K0 B?0000?0  R09* 0yS R h!P8KD0C0`@4VI 0408K<0C9 9R00kK0 <AB``?98K40C0P0 '90S 0 8K<0C 8KD0C 00"!P8KD0Cl80S,x tA3  Z8K40C K 04A 8KH0C0 Sk7QG<80SC 8K<0C  R0S:R;h0S8 8(7d 0K,H0"0 !P *70S 8K<0C008K<0C 8KD0C 8KD0C(@8K<0C (,60Sh0 0!66(PkK?H0S  0 # KDAP0L M%hP 80 8h:)8)(9)7)7)X8)p7):)2)88)h9)9)9)"9)8)l9)#9)9)pJl7):)u -LM07 0)Kgǟp,0S)4E>@C0A  ?ƟT0_X KMF 60 0  V唠0, Rd |6 (K@唠?J*@$\0Q @ ?@_PIK@P @_)KT0)K 0)K 0 p1R(K0p (K R0  00(K0@P0/ `p!. 1`R0 V`` `0@& P0  K/0$\Qc  ,   d00 0* 0 >h40S`40V SV P4Pd0S0x000KS Kpd0,P0%  0P 0030SQ 30SM 0#S 3S K0#S\0?0P!. 0K K1 @A. `S ) sRPK0 l`pHK@TPHK`|0 僑20 ` (K000^ K0!Q0SR 0D$0P0 $ E00iKWVC])KK`p V0QP 0QP)KD1K0?S\^!! K0QP`3p3: `P0 @ `00 00)K 0)K KKQP 0!SR 0 P (KSR* JDX9)88)T:)`9)9)<8)9)7)9):)@8);(&9)H8)U c\9)|2) -LM @p 0P̐00 00 00CS(K Pp`0V QP p @40 40@ R0Sp` 0R @P2)L:) 0`( "4`#/ -pLlMX K8D0d`<0KT10 P1 L1 0,0SI8A0S 0 ,Pd0 0P N00@ P 0D R`pUT@PP 0GK 0RpQ R8 tQ 4  R K  (K88)d9)2)@8)(&:)9) 0000@/00S 4 /9)00S0`( "4`#/9) 00S/"9) -ML M9P@@XH9 90S P h9 QP*00#0_`04SD9 ) (@P$D9QP (P80S= 0S: (00P./(0~KS069K0 pG< ,D59K;0S@80S69[5)[59K6)K5i[0``S`  @P ; 7 #R0hwgc0哮KS069K0 J< ,59KY;0Sp70S69[5)[59K6)K59[000D9 #0#    5D90P9@ -*-&00C0 B00Q0l L ;@pPL9e 00$pS 0S X&`000,P$6pQ cP.\V0P% .P%PAPP5P}{ PgP  (',@ '#`0 0C0}B  P4`@ Sa 0H9 ?P 40 e 0" p4 !D9Px40 hQ0 L4b0 0D) 0&P#P ib00C0(K 0#\0pß `SP` 300isP@3 0 0`D V PQ`444-p0AS񟗧ȲTQŸ<20S40000>P1 d2 #R0~ `2 0#R0sQ# 0ST20SH 0 P` v   P000  !0 #R0  CK K 0p@>K0C`!CK\ 810 S) H0n#R0 š!ʡD90S  0R %KA 0 0 00p0P`000C0V& BxP`< :)9)9)t9)1 *C:)G^9)jK[l{ 9)H8) -ML MP0AS񟗀p̷p nP 7  aP 7 00QP  t7LP t70S \70XGXg]KT7  PE+X @0D5K(7p5 0E 15 5W2:7 Rp5SF5@PQU`V:(K l PP hp& TG PF0S : 5 0 GB 0 00@(0S S蕟腟%E=(0P, P5 2  B. ! CK50S\ 0C.K0(0h00`0P X50S Ll(0H=(0 50SI Q(DuSK,@)@$ RKR@ ) HZ(, H: _ Y 1 #0R) Y $ $ $ Z 0=Z@ ,8< SK@.  (  C.K /S>K0C( $ Y 1 #0^ Y YK L S>K0CY>K 0C ' RK 0 H5 H5%S5p( 5 R , ?"Q@,0Z(5 0@H  5SZ0Z@ ,< M(5S '@0 (0S "|QP 00S"0P!P 1 !00C0P t00000C0!" !rpd0Sr@0q !SRm j00@h ?:)/=t9)7)8)ЪLp9)CF_@8){(&:)9)H8)k9)9)00S0`( "4`#/9) -LM"PĂ1EP Q" 2@T(K0S x 2@Epd0DAG@D`Q0p PP00@!SR !0 Q2Y 2Y Ao1婒0SY QP000Qꨡ0a  R R@0 S "1P <100C$o P -X K^> <"K/K 募K" tb pr Qp@ `Q8 t[K4 F !Pc l02 K d0007)8)@8)(&9)8)H8):):)r:);s -L4Md0p<0 张4 P@<? 9\%d4R@`  0   0`00 0 b@00 640S30] S] 3 H0 R 3H S  @ 0 pL0 2D0 0<`堣80 L0< 00CSG80TS! P3 80R000 A`pD L3`A0 00?b9` a2! Q,S Q0 p@0B*-"220S P PB8 P(KS @0 X P080 0/ !0. 1R R  \"o 1Q_0T+ 0H S`? 040 |10 ?840P0K P0  00#K04 "  R 0 H0̐S 0 04 $ b? P0L  80RT $0A0$0 @ 0 @L3D 0  SR 0< 0`p88)X9)T9)7)9)U c:)9)P8)d9)9) 0`( "4`#/ -`LlMX K<2ܒ0 0,0S(KB0S p0p,Pd0L0P 00d20@@_10 T2 00S`UTIg" p "WpQGK W8  Q4 tQ4  W4  XQ   0< K ARRTpd0pW! 'P 010S  0@PP 00S  0K0Q SR  0 0, K W !000S X P  0<88)@8)(&\9):)9)h9)l7)  -MLMDn弍@P20xK0,pG ;0t0=0S5X0S+$5S/\= R L 0S 0 $5堝= *f ='=0S 0 0 'PX0S$Y\YYѰY<`0V\0 PT0! X \  B; 00B(K1/B08K?C\ 0K00B!L100$Ŕ`\d0@h0;0Sh`h0QBQ00h0 1l01d0dKA@<KzAV000=S3Lqo QT00B' X TS0 BB$51`R  B Q1- 00Q  T$: R( 0S  G봐0- 倐B$00B1Q1 `R)B!!@ L0 PP4 0 sPT t:P\ *㠐H:V<:0S M0 0<8K!>C0(KA?/B08Kz?C0(K3A?/B0 =(K{/B0T0`(K~/B0(K>G/B08K?C.:89 0KLVHRKLX0S8K(K,0C>C.B08K>C@ :8=`C Xa08Ku?C8Ku?C V0m 0KwA 8Kw?C0(Ku/B0(Kw/B,0 Su8K>C?^ PG 880S KAA> CKA˄KALKA|8K?CEP7 8K>C@ ;3000t7lG*`7T70S 0 0(K0(K{/B00S8K{?C`0/ !. 1R0 X 0`( prPf0S pd8Kw?C0,8Kw?C0 8008Kw?C8Kv?C (Kh?,8Ky?C`8K>C0.B00\5Q 8Ku?C008Ky?C  ?KyA 8Key?C  ?9 250SD50 S 450S(Kz/B0 S (Kz/B3 S 8Ku?Cd0S t0 0040S 4 0S0Sy X4x4t4 ?s&(\0d^ hKuoF`p` ?`d  B2h b:"6>/K h?)KyA`KALKyA``p 0`AKAR`KA 3pW=S(K,A(0K,H08Ku?C0(K 08K?Cy/B0 W`C`(K,0u/B 0CS=S Sb 2 \2 ?,(KyA 8K>C0(K0.B0\2Q 8Ku?C008Ky?C  ?KyA h8Kay?C  ?[0S 8Ku?C1a410S Kx@P1`p1Pq0h Y\10S 1P0 11 ?s&(\0`^ hKuoF`p` ?`d  B2h b:"6>TX9)L8)9)8R}:)9)2i9)m@8)(&T7)9)8)/Y9)}:)h9)9)88)P8)9)9)U :)H8)R9)2@8K ,0C! t $5S88K,0Cp 8K,0C $  ( RV ( , RV``0 `RQ W ,`0 xp x Qxx hK,`F 4%8(Kz/B0 ST8K{?C T8K(K,@z/B0 S\08K?C 8W =SL5s(Kz/B8K ,0C#p8Ku?C⸠0hK,`Fß? Q)8Ku?C0S!8KK,0CzA R\ ?0 K 8K,0C zA B  R\ ?0  (K, B 00C 0`㨢KA08K}?C  8K}?C 8K?CA0P|||   K BzA  R \  pRB0/  8K?C!0.0(K/B0 1 R R KAQ"0(K/B S `000^  ~aR8K}?C0(K0}/B0(Ky/B 80 HS(K}/B SvxK,pG0008K{?C0S0 d0 ST0T00! !8K,0C P RP%XԀYdp0   000$5S`0V3S  K,Al!s00`R3080(Ky/B`8KKy?CA R0;D6(K0/B08Ky?CЀ0(K}/B08Ky?C0(KK,L0F/B0{(K}/B R(KK, B}@$0c$ Q`VvaRQ0\04 0$5S(K, Bl0`0hppWS $%S0! !K,@$0(Ky/BK0yL@! `a(K0}/BK0}L ``(K 0/BK0L! ̟ L` 0 8Kw?C0  `P= l80S  0K08K?C0uA 0008K}?C00008Ky?C0 8K,0CC#P8 8K,0C  i 9*9}(90S t0 0H9xK0,pGS b8K~?C `Pi0ST0TST8K{?CT OP! GP9 8K~?C 0K,AST0TST0z8K{?C To0 0H:0SxK,pG0S\0S\8K?C P BGP 0S\0S8K\?C jA0 08Kw?C  0 p0S $S00pW`S8K\0}?C000S\0?000+ (K1y/B00+ Q\QKA0K8Ku?Cy@0#8K?C q8K(K?C/B0 Xp(K/B 0RpK(K,I?}/B0(K!.B 0WlS`0?00S8K`0}?C0000+ (K1y/B00, Q\QKA0K8Ku?Cy@0#8K?C "8K(K?C/B0 XpK(K,I?}/Bp0 -p`@HHLT(᫶P P⦶U @`` -AL0 5 Pq 3S5(r`1 0" 0SV 0S 1~0a0  la*I`1 T10S 0 0U2031 PR5 0S Sa@ 5*< 5$000S 0 0@TPUKhP\0UX PH0@ P,088)9)k&9)P8)9)%:) 0/2)0/2)0/2) --,@LM   r(& -@L}4q0 R P0S 0`Vص`  ᰭT\͵W<@0S ㄵ0S1@ 張ڳ2)=7)w~ --LM  K --LM  K --LM  K --LM  㤳 -@L]M^KMa HpH@WP(KBK! A޾p@P,0KD@hBNKd @DU.K B% ;P%8T5: S"HQP0 00PPKAP4: SpP% S00S BK  @0PxgPPU BK @0P  5 s5P@2)D?2)<N^x -L0KMc&0PD@  04  ⑴ K!K 刴6)³ 0-0LS 3/ ٿD8) 0-Lc30 @(3 0 #W3@0`;) 0-LO3@'&##E3@01Q0@?o-2 P  R2 P0S 00CoS00S00 \x PPP TH LQHH  0000TTT:)9)p9)<8)7)T P0-L@0,00S NYK0h9)=N 0-@P0L000 0 0022=p 000=000X0X0<0<0@0@0\0\0H3H3L3u/L3P3P3T3T3 h K0h 0-@P0L000 0 0022=p 000=000X0X0<0<000@0@0\0\0H3H3L3u/L3P3P3T3T3 EEP  4K44K44h 4 5 5d0d00000P5P5H5H5 @ A H5h H5S>S>K0hF0 \\L5SPPP PLPHPD,,P@00P<44P888P4HHP0LLP,PPP(TTP$``P ddPhhPttPxxPP PP\\5P//:) -LMH8 @T 8T8t0؀ YX+ 8  ?#K:T0#K @P @(K0\kPc0S0 30S30S  ? -:K TcT00 P0\CP434#0S, (#S*  P S0S 80rS tB*0S i@异\hp I/o2" W ڜ8Y 0R00 4<, 04 K0 4000 d0? K,:Q00S8,0 0CY    AŸp 0 ? 0pS]0S |A吁0h OX10S  P L10S @88Aqm 0S *0 00S 0 0 0@0@ C]hp帠ppHQ*0 R A 3 9):)9)8)c7)9)v9):)9)88)T:)8)9)h9)3P8) 8)p -@?ML M@0_0K?A`P4X 0 d(KT0S h^0SQ 04(00S  > > > ?   ,8 q@ mT0  h,8Oo,  b,0(QB@R  P >R0(  --P @T P  48P0Sp=0Sx i88 dMR r>K 0C0>K0C p8<.00P @=0Sw0St@Tqe>K 0C80>K0C p 5[S  ZK @,P ZK @,P Z.K Bd k)YL d"7S,8 4  4Z  X  pW   KV. @,(  ,0  (5 RISH ?Ѐ *` \ P `5, S<(0Q p,t  (5`# qP `5,(S>:*0:0: 0:娰 0'0p5 Q$0Qp5 0Bp5@0  p5 +T0H+, t5 +!KA ,(0{*G  ?00 |: PP`pI)0`\Q=S.90P 5` ' 9RV0 S @\h SX i 5*< 59 90S 0 0`8:0S 0,|9 0 S` V 880S(8Qm 0g0xȟ-B ,K) 0 NBt D ``b(.`(.`p .K x B 8gR&( R"=S0S ' 0Ї<<00P%X30*7Z 70S Q0 00S5h70S10=S-0S D000: p 0L%000P%X30,-v *_! 60S 0 00 <0S P 6 %PF0 5*>P6 `60S 0 000SP0E0* 5 50S 0 00<cQ<0P 0\E<0*`5 p50S 0 0D0Sl0L%r8 Qڨ0Q2ڠe 0 0S lZ0S t*4 40S 0$ 0 0 P P?P 0S/0L%r+ 0QQ%ڸ(0 0S xY0S C*3Y 30S P0# 0 0WP 0H00q&  000cH00S Y0S C*l3- 30S $0" 0 0+P 0L40q& d 400cL00S oY0S TB*@X2 h20S 0," 0 0P 2@T p1E~Ⱑ p\  P@TR 0 @R 05Y0S lA*p110S 0D! 0 0 8)9):):)8)9)9)7):):)88)9)lEl9)DzBTq =VTx<:)"h,G\:);`9)9)L8)9)9)9)P8)8)t9)7)9)9):)O\9)s:)9)9)7)h7)8)7)X9)7:)H8):)q:)X:)8)LBAL;oSY9)9)h9)9)I8)`9)|9)Cfux9)Q\ N R  H4PU XAQ,5SڂKSΌ A SR( 0.KS> B0S kX0S q*<110S 0! 0 0,P 0(0S& xQ* P0S< x 0(%0S ;X0S |r* x2h20S 0" 0 0<QP H= CSR( k0H  ? A0S X0S Ls*H3830S 0t# 0 0P L= SR( 90L  ? 0S PW0S t*4g40S ^0<$ 0 0eP  X4 0S640S20,5S.0S $0 000.K BЀH ,5S> <0(5? @L u ? *d5%50S 0D% 0 00SJt50SF0L5sB0S %0000L50P5?T5V>X50$ő-00  B00B1\!`0 P0BQ@5,F00L 000*P6@60S 0|& 0 06 PR 60SF*660S 0h 48`P@PL, p,x 0x `H   ? @L  ? d7;lPG|P|,8LS@D00ET@A,8P80Ÿd 8 B2 b>@"8<_P 08S 008 80S  <80E A d ? B2X b>@"8<x80S   0,(00p0,8 ,8@TPD8O@ 0@P?`@i9P( < ,@_<9PH 2 P9 Q\@_ UT@9 @99?p99oPrp9W @ 9P @9@C  Pg:0( N_0 5 @: pH:0S 6[S gKd @&P 8: K:P@Q Z @ 0P@@ 04 8 <*c#!$c4"+S :Q  4 P 0  0 W0  0 0 0 0;a(!"4a#Q  ; R U0S 00 0 0 00  0 $4"48#8 S8 (< R D U0S 0 0 00l0  00 $4"48C8S < R sU0S 0  0000D0  00 $4"48#8Z$: A/oQ" /Q Ry = R @U0Sh 0*000  0000 4000 P $v(> R 8U0SE 0@000  0 x> >Q>+,>N 0S > ^ 5<00R.00.@0.0P'5PFSPdv$|Pw<uP 0 40#400#0`p R W !0B8#80P 審@PU0`PVt0lpSW0QN R  408 08Y @D  @|9)`9)< 00-S!4!: SL  S  S  S <0P0d S  S  S9)h9)c 1-0LSp lh$@ T L10S@10S0:(1 10ST00S )P`"00CS0 @ T @YT ШYT0 @00CS0 P 0  0 0 SNT9)v9)9)8)9)x&& -pH0L0@S` 㚨 0!|P9) -PL M<1P81P4100pP1 P PyP 0` P P`` yP 0(00 d@aoTP00 UT X P(K PY` @@  0P:)H:)88)9)X:) :) -L4M0H 00 1p _%#HCK8 080 #K 0 c00P 0 Pi0 &<K0`040 00V  0 00P40 4(K?P#K 0  H7 PP ! 00L0  ?$KL0P SR ,@P? "$K 0< 40040 0`p$K:)l9)  -LMp0P`80 @ ?#K0..&#K00000 #K  X 0 (K 0ϧPxX (Ko膧#K ?  8ȓP  ? ᶧ0P:):) -LM 0`S@ PU 81r (U$$ P0 PP0 0Tp0@T(KР0 @DLc0T@S`  80E A ?#K00d 4 B2h b>@1<"d0S  0P00p:)EP9)88)9)9) -LM`pdQ A\ a2PAl 000 SR P0D D000p 0@pK88)=)9) =)8) -LM0P@T@Td `L l0` WV @   00P00@@000$K :)88)v -`p@L\MX tK%tKeKT@ KШ 00-L@S%%4&%0H0S  T00S HQ0004,VP0009)< -D`D@0L P(00S Kh88)X9)9) 0 /@8) 0-LT @UT0*<r80@400 ?1Q09)\9)88)k& -LdM`SR00WV0S@ d `Q 0S  BR 0(KT K0 ~$ 0Y0*X4u0600S -0 00SO00S 0P0`d0R 0x40 $KkxP9):)9)8)9) 8)9)9)\88):):)P8)9)AX:)9) :)zP:)H:)Զh9) =)=) -PL$MD3p00 8Q03A @R _3CK40 ܃K_R 0a@ Vd`@ 0^ PŁPXU@TP  \#KP 0#K ?#K#KPPR  ?000 &2@UT :. BSR00088)^F -QLMPp` "K< P9 P40P0 Ȁ0S 0S  BK @P@ @@P0 0S 0S T0 sBK @P@ @@P 0 $K|9)P7)`9)Q 0`( "4`#/ -LM@8 01 00 08Q(KS@Ppqa8Q0Q 8 40 8 40Pdt`pP `0-LSp7T7,77@o10 0000000B!000! 0`-LQ 8777o0! 2B1   P" 0`-LQ88h8\8BBA 0`-LQ89998BB[g -L M$5S`@Z UlQh T  10t0pcR40C<X001$0 p40 0 0 40R !S`V+`F0DS@@ @ C@.Q%@C00Y T  @V @(K ^`  @ @D -LMR`@p >PP xq_K, K4"` hP(KP(  4 Wp0S  Ȉ<08 (00,0 000040!04 04$0D0(0`P 7qW h `yh20 a ti hHi \Di P@i DK P0C)P,ULT!P0#  K -pLMnKM `F@P,~ iPut=(~ : Sw/(30P  rR 00d K0C P<#@K @,^ WF(>S T@ KA $N *pPVt=: SI^KPE$>"ݟd$^ @PT;PW0 KASR000: ᶩPF,P ZU $Tᨩ@zKKAP( PP@^pP S(^  S$qP@p-p$iP@ pKA$P!0#PU00`q> K0 @mK @D@P.K BͪPN0SN`Y K@ҺPPxᷪ^K PE E`ᰪPH᫪P},P عX% (K<D FRF F@00S 4 /9)00S0`( "4`#/9) -L M`t1pl100 ? 00K @X_` 040P00p  !lRRQ00S" =J% 0%D@L !0ZXt000Z ` {00@@@P80(KI8)88)\7)\9)Sx9)rC:) 00S/9) -L$MP8 <0 @`pሡ0T000(K00 ?V00P 00K0 08000P000S -00 ?00<00 0  0|W0# :> C0TL0S0P8P 088)^F9)R/c -LMԀ#K@ 0K5 `pX0P` - `0 X(Kf  ecK`p 80 80 -@LM P`p 0W0(08#8#48#8W00 T< !<04080? K :^FF^: -@LP`   ~ z -`@PL ((UX0 c#!$c4"X0C-bAYXQPYX QP#P00@-P40@00 P0 SR0 -LM`p02#W 010!00s 0 4 CKTK 4 I W4 c>0 S QR Q0 R @P@  %P$!#K pG04 c>0 S Q\Q0 R @P@  P CK!@PbT  0 (K,/ = 0-`L3S t0t ttATpAS`0C`pX0<b = -@PL40S:aSʱd0d d0C800S   0尳0080PP80S0 [O=q ,00-SL@0\00  POD,厳0,0080S $0$ $$0K0h}`7)qc = ,00-SL@ ,0, ,,TP gK0hcv = -LdMd Xp`P (88S0P P84PE2PE1PESPE50  00 05X  /\Z㳰PE` %0P@0 D5Q <ۘO0@0 ?U 0XR P(00,0,0$%K! 0HL(0#$K#%K0@p ` $$K0@ 4$0IKeK`Pp 0840  %K %K $K(D 员D, 001"SRS 3S`4$`V:G001V#%K 0`F34`D0 ccK#KKQPd0@ #K,<0KD JPP,``3Q 0Q+ 0CQ܃K 0PpS #KT$PPP TPP! P0TPU !fuPP !T]0PPP 0p ?&K0U 4 KeK#KQP LCv 0R3`0 0$KL `0SPp&K܄K#K%K 0P YX1!?%K!< K 1$K 0㪯%K!4000!R 800800 p2K0U0XZPp$K 0P 80S0ո ո0C800S   0垗OP:^@P @(K0@0 `7)LBAW= ^ NBAWr[  -LM0@,0S0 0`p40S* ᠱ(K00QUp! #K40K :`P  o`PP= -Pp0LS,0S`@d0d dd\Q L0< H 0P@DT: =; -LM@p0C,0S`P0 o,Q x0h t 0P ! "K,0K P`PEpU$KK =M p-L MH0P0` 8@ 000 ɖ `Kp`7)9) p-L MH0P0` 8@ 000 ᮖ `8Kp`7)8)  -0LPQ P pl;P㯔.@L`Lp0P R   T0! }@9)=)<`7)\ 0-0@LP0,0S /000=) -LM,P ,\  ? K=) 0-L@PZp00Sh0X0dSX0`( "4`#0D006.8 Q= SR00:)9)88) 0-LM20S S+,|2 xR0 EL% `Q0 \\XP+D`P01 $gpP0 P'!&z "v ȭWd \" ῭1S1@ 0PRm `VeKtp c?KQnP n?!n/ 1 М1h0P` !0S `0S ! B/oQ" R!Y1SY oKqK+ QP oKSR m0e/K$8eK Pp$`G0p2 0$ p+ opt"QP `T D&k&zd@  Ye C d -`PpL4M@0` 8` p@'00S000  20S$0K P W 00 PT 0 0 0!5PT AT tm@ fT pT0Kp@(Kp080 ` 0pP , ? 80o0$K0 00 p 0C p@$K`Q0 QP p V@p@`_D&e{k&U -@p`tL ]pPT10S D$KkfU rU`   oYXp1 .Y $$ P npP" X`&00S $$ ?]pPl W`VP$$ -KpP$h3D&l& <  -Lgo=) -@PL`pP 40d `:T  HH4 8忤U  ( Kh( KhkN=(&]  p-LM R0`@KpP (KP0( 0S 0SS0S  1# BS0S$KP"K0 (P/00#01"$#0G-`@V ^ p V00`@^P6 UP@ @ @7 TQ@T* l@Q @T*?!Ì?@T*, ? ! G- 0 @$a$q$@PU# \ \0@೐00 0\@ \@ \@@ ^S(0\ ?P\CPT 0S*$Š@L6ˌ7ˌ@ R@ 0 -LM@$0 @{PP 00 0bz' 0QP P(K P -L M@$4cr'@P  0QP (K  P404 --L M 0 K --LM0@0 2 0K --PL M 4 L $  K= -LMP`pw@P(K P P 4S  0d]T0P$  $QLP 0S 4S $ X 4P S $2SW1V!` WV000 0 @ 0 P $WV  P WV4 T`嗆#`P&" K+K R0+K4S 0 K+K " KG" ` KlP\ 00pP0S p e]a< -L`C$$0-0 00`E؀E$T0  P0`p 04S `P 0 08p P$0KP#0 0zp P 0p~  V0pXvd@d@1Gc -L M@P 4B BR KDژp 4^4 iUKd@ 0-LPP@p P@ T 4PS "04 0C -p @LP0T P ` X`p@0 p@@]s$$ QR "( / 0T 0< /$4 0T 2 / $4 0T 2 / -LM`PP@ p ԀԐqT! 0 00 ឍꎨO0 `吐P  `0 00l0T0ᆍX:(K 10 00`0( 0 u(&T  C-$$L0AP p-LM@ЀX P`00 0Xg Kp,K P 4"KR 0 S0 -L|MP_o!R0`@R(0S00S "R0oU (KP PU 0SMpWJ (0WSFP0 QP>P0 QP6pG)00S$00 P0 P! 9/p  9/p 40 8 m0 K$8K0P P -L@pP`sP 5/p 4 5/p 4   -LM`0PS 0$K$D0  0  0P@| 0@ 0V 0*c - 0LM 00 Pz`pZ(K0  8 40 gP 408 0S L0@`4oz@  0 00 -p@,P,`L0 0@▋T0 -逐L` pPp@ 0 0 <0P8  @T0 -LM`PQ@#K  00 (KP P0S* 0E8 nP8   ` pKp Ec` pԃKp    p-L M0`SPL@ KrGo 00SP Kp0 -L iR sR aR  p`B>s+ 0-LP@P $0)P0^00T -@LT`P,0ڥPI0e bR0-0L LR aR 5 sR tR iR(} 0Sڈ&0000p`00B @P 0w0 -LM`@$Kp`YP0 $0K0,V$0[S $KP KШw~ -QLM@` Q  (KA^p P$P tB^dp0 00 ` 0P  QB@ -L4M @#KP H 0#KK(KP 0  0 00`p $V!9# SR Q`p `p 0`p#K 00b VR`p0SH V0 SR$ `Rp 0bp $።P 000 0` 0pPԣ4 \4 !#K"4 #K R0$K R0#8]pu $ $&#K8 '#80 <0#80,0RP PP PT0PP0 S&Z^#K pU 4 0 00`0$K PE 4$$  n 4  !4 "4 $9pP0 /Jh 0-LM0@0S K0C^ E$E$$0 04P3 @x("(!"`#X80P K K@P8D&l& 1Hfz}0$ 8 -pLLMPdK4 h 1夡00 ! ~p h0S# |! Rp!dK(KfR lRI dKHh0`S ,DP 0@P  )[h΢@ QPh Ԁ hT 0 㝈 0@  T p p0@h  @hP@hKp0D&\Q4l&x&e -L`p(@P)P0 `@00! 0$0 0-@PL0$0S lK0hh -L,M PDT KX*`` pPcK%` SR#KSR00S& Q UQ 4 04  0{0P 00P$0 @TPzK g(KQ UQ000 Q1!!U111 Q[P  tPPH 0 Q 00P$0 #K0@S0PT#K P KP`p`#K 0cKWV0@S0PP0 X00DP `` 0K؀ #K X0 00P0@SP=< 4$ PpW a -L0M@Tp0`" 0N0  0Gd1"p 0?0  071,$ 000XC P` R#K0[0; #KV05#K V0#K KR 0K 0R0C"KR0? 09T0 K 00 1,$"K(00(0 0K0 000"K #K 0 $KT0K 0#K0 K 01,$K0RKcK "K -LMԀp` @PEJCV@@P(K0Sl@ #K 0P 0@@000Spd 0 H1"P#KR0@#K @K T R0 0  p0  0 i H1"P؀T 0%V@ Q  X0P Va  R0 X0V Q #KK T 0Px qԃKX  T0 0 0000Sp@^ - Q r     P/0S//P/0S/C-؂ Đ\ @ `pR0\ @P  0  0V0@@ P Ѝ R0P@P -@(MLP@`puP8RK`$ <KVP0  4  -LX@KP HHH0H@@@B@8`8P@_T㱃T   (& 4 R-L R R 8R Ri  R0-0L@P# R" +:R! R! !S 1 @0  0R R 0R R00000000D =)  - LM0Pc@P(K0!S R O`(p`^P4S 0l0$$0KHH00 80 S4S00r 00!S1 !@傄10  p 003/p H08  0( $P 0 0 KR 0"`p V0"က00000 0S  0R0`p WEV   D =) 0-L4M00 0@`pt@0 80 <0  zpPL30S0`KqP 0" fU AU 7P(KpU sU080 0KEp0@0 0<0 0D0 @$KB0 QP 4 `D0}p0ᴐ0P0 0T0 4S 0S200  R RR*R 7:R W R!@布1 R : RRRR*R :0BS<0SPR R2 R80S$1 +10` 0`Xpzpu ypq D0o_P@ @00$Kn 5pPP^]Z8 H00$0P T0 (  R0"`& D&, Pl&DF  T=)_ P{  -LM@pQA^p  PP`|t`fP `P KpP 00 PꝒB@    -L@`pP* tV0Anp `Bn $$ 0 P ! p" $ppP 0 0 PꝒB@   -LM@`pԂ GypP920S7)`pPk 4S $R4T QyP N S$ 0"SR [ p(KrU (KoQ P` $ 4R  4S  0P  0SS P P 0Kp 0 0 0  0P+, ?o  010 00 0`pPth$SP V0p귺D&= T   hl&{U  -L8M@P`4 TKp0pp 0  wxp P00S 0@ TKTKpK1!D&4l&  -L]=) 0-p LLM$K#K#K0@`ȂH0  @xpP=20SG#KR0cKP 0SBQ? SR;H #K H00$K0 QP`p) ԄKH0P0 0P" P00CT0  ` wPP cbU<KP40KH KDKpP(K$$0 KZ8=0P R  WV 0 X0 %K0$PV0%K   00 QP ` 0`Rp`0bp T 0bp 0  P gD&=)l&p -LTM@C~,`K G f( zwpP  50S P(KsU P0DpP#K  00 QP  0x#K$$0G P0R#K 0#K<  00PX0  $K0 X0 0\0 P 4 "$K  4PS 00$Kp$K\eP < P`   KYXĔMPxPpT `g#pKآV :`K X0P0 0 d >Pd %KR0K`#K RK0P0T$KR 0KKX000X K$KP000 SK$KR0J 4So K P0p``0`4 ` 4 "004 R\ 4 !4 "4 R$p \01S$>#KR0\0r/s?¡á[±< "( ñXpPn(X0܃K 0p 004 X 0 00`00Ph 4$$  <7D&l&0l=)=n -`p0@PL$M,KcK`hl@0 vp'#KR0ԃKP 0SFQC SR?@ T 00S< 80Q `@TbP NP" aP ~iP lP|(KT <KpT T @K}`pD&l&4 -LMԀP@P[ ,dDLT\@xxM 0 hsd`\XT 0 ,d<b @qώ0Ph #x0 0 SR- @TJ $m0E/K8EK@00  K5K01S1St $Kd2PPP P MTw^m|\}C p-LM`0%! 0 T$KP0 $0K0,~$0[S $K~ ~Kpw~ -WMLM`p@T XZQ0S@8 P~ , $$0$$0 QK0! @IK0  @IKQK A @OPQK  @&I.KQK B A~IK0  @IK A~-Km0 B$8,K A\~X~#L AK @|)K<}AbC`@-`0 @CT`@ pT00 P0S@XmX0X x& -ML MP `"`J~\" PF~PB)=@@r@T K 6~ 2~ `Vl (~   `RK0!@JK0!@JKRKA@PRK x@RKAh~JKA\}JK0@!@JKA8}4}$ !0# YK @P$ !0#} jY.Km0 B$8sYKA}}# BK@4(@YK AL}}  ( D%,+=E<}AbKv" 0-p @P`LM"K,0@  sp20SyP(p( ) gP aP bP =p$KlP uP iP0KLp@@,Kx@@"KR0L܂KP 0S Q SR0 0Q ] 7} 3}/(*`ᰀ尐V &} "} Q l}   ` }PD&Yl&%,+= -LHM@P`4 TK7 dK0p 0   sp T$  dKuP 00Sd0K TKTR lRxKTdKpT8TKp=)D&X4m&  0-L M`00 0@P"K"KXq rp!"KR0bKP 0SBQ? SR;0 T 00S"K0  0 *a@ P xTt),K{pT $KoT 0K3 KD&$m&4 -L(M0$00 0 00 00 00 00 0 00000000 {$ KE 0-LM@P0K0! D0K0a >0K0a 800 0 0 0P S K0 -@L$MK3[ >K3K3[3K040K 030K 0  0S0sS@04)  H0 fPH0 Kp0lS@h噤( RP 8p m(K@T@Tt -LDMpP<@K 0S  o (K-0K 0.0K0/0K000K010K020K 030K040K060K0 80K P40[ R 0S P0L哥&@0 P@0:PUvt p-LDM`P 8@ ] @\K@ \K6/TKpt -`@,p,PL 0 @0{ Tt -@P`,0L4'U Kht -LMpPP 4  0440 00 ,0 (0 2[:#:92K,0[4K@0<<@,0K tp@`4K K _ PXxv@@ R00``Vf -L8M@P`4 TK0p 0  pp T 00S0| TK0PT0S 0X TKiT@e0KTKp !D&Dm& 0-@RLj 80=) 0-@RL\ 0=) -@PX7LAMPgPw  $1  pp ,70S  (KoZ0$1 sRpP 1$M P BSP 8@TTPP AJ|$PF $z@P $!hb00CS;RP P\] P  SP 0KK o_P0S #R`P K?KL P RP L Pz RPu L Pp dRPk L Pf @RPa L P\ RPW L PR RPM L PH RPC L P> RP9 uL P4 RP/ kL P* hRP% aL P DRP WL P RP ML P {RXaP bP{I vIK?K  0KK SRP\X  x XRP `I \PRP 0 `pQPL PU LIMVan|w} -LM@`p[ np ;0S  (K0FS iSPC>`C$4P Y)P$P YX 000@:PS0P0 ( $PP$$0rKPHPPP PP (0zKPHPP -K$    Q0h00 PP 6BKP80P ^  P0-K0AK0 0 0 -K R0.K R0/KPP P0P0 d`P⴨ .IP+ .I0$⒐PP 00 QP\ 0S$I,<, 00 QP0`KXPPg AK`PP  Pᴑc KP ?PPN J`8PPpF J/KR000A/KV 0S @ ᱀$4P $$妀$4P`0V P`P PP Z&ZOP _P 0嘦#81 H`PHx&?  0`0 QPvH<OP 8#8 00\!-K"08(0/K#0K ,` 0$0P00 T0jXf$$0`D0 QP>$$)$4P-K! 0".K`$G$` 0 0!0 QP$$$4P` $\Q0D&xm&= ;]=)xwE U&&1>MVan|S/o -LRM`p, K0 K! .K! -K! .K @P 1 1 1 1 0 0 0 x0K0 p0NK0 h00 `0 0 X0  0 P0A 0 @ P w s.KKi@,i,!i- -@LM $K^ $KC 0`( "4`#K 0-@LM PKH K⚢ K)pp@ @㒺 K4p(㊺0K0-'i - p-ML M1@0S1`0`S` B.KH0x1 P h!hBKDBK\tP 0`0?o0c Pc U %P PP t0 0B.K00`0r P BKBKtumt0 0B.K00``0V P P PBKBKTxt000@ 0KpK0mtKpC)C)0-9-@-M-[-- p-L M?PP  K!P  ` @T #KpP  00SYV  s@-A0 R !S -LM@@ Ppp`#㲹P"   LP1 W< LP>LpP WpL0P W0/ Kp80 :P/[80) h  <D0 8 . K@pD0! / K:Pr /0[SohQl @ ~pal W"[ R R RS 0PW l S \3X (m<*W 0d80S, @ h~P@ `~pd HQ L 40R !01Sp0S 3/p\ R 8 Xp~p \ Y </@ `c~p (K--4 c--U-<---. -L`uK@P@KPU DpP ML P 6C@DT jKLP -LM K!<P K谳 -LMPp K;@P00vp` KP K6 K∠ K0}p *[0 ;-i 0-L@p K0h0 -LP`KpPW00HVP@N?0V  F -LP`~KpP700(VP@:.?0dV  F -LM K$;P00 K -L8M@\ K(P:P1!@KP# 3VTK܅K@0X 0`xpeKX0TK@0 UPP"  OK@XB$`$K< KlTKBV.#.d.i 0-@LBMMBK  @aB.K Bp! $R 70AK0?  @☡ANKP@D0S70$0AK? h @∡ANK`P@D0S K0q@q@in... p-LMtPJ`P YUP@ T0T VP:U 4K4 K0Bp [Kpd..#.i./ 04 8 Khm-m< p-PL$M@` 8KbRKP8 K,bK P p@@UKpi1 -L M K8@5P(0( $j [K1#1 -L M K8@4P(0( $Q [K0/1 0-LMP "x@P|RUK0 P ^KPE+4wP8@ULw8[S8[S1iS12 -L M KP@F5P@0@ @@ ![Inp$1K0;A1&2 -L M KP@%5P@0@ M<![ Mp K9 E1B2 -PLMM`K @0K(K,J BlWJl 7JPP(K7Z B00'S0P(K B0 0K`PE( 0R p@P8K0C0(KS8K0C00 B'U0 ʰ:(K0: B0: 0:0:0:0 :m(@K !0!@ 3 P ?L0CSj 0     @$@!#   0A^ E0y900Ipp0cpp0Cpp0Ppp0 Spp0@Bpp0A/0 P`D9(K0`P B 8K0C l!0(K@"0 B08K0C0SG il(K B 00B(K B00'S(K 0(K B0o8\ 0C\L@|8\  0 ೇQ  9F0C0,(!%,8\LL!#xN L@?s00R r0S S }:S ' R #S S S S 0S< *SL70Sl T2Sr S`V 04 8 <'S%l60SQ 0lfl 0 PTXEXx'x0YK1 AQ  pTXEX`F(0`(K B0\@6Y(K B 1P(K B SeQPU31k-50S K0 p@}8K p0Ck(K0 B 0K BA @\% R %SP`ku倅P`0FU>nk0\ 0 kH40S4 k40S P`0 k0$0CpWP0  B ~k`P xkV6 40S  !(K B0 ddk8K0C0I0LP $( P($ $$P $ ğP$ K@0Ek8K0C`I0I#S0S P5k 30Sa  -k\S'k20SS | kP`ps  0 "  <#0 4` kVPT`kT20S. 0hjnTj 0P pT82`X1 p 0F`(K B0|2Y`(K B P%"1R(K B 0C j8K0C0H $( P! !P! P! K@0|j8K0C`Ih0 S ST  )!Sx "Sp I'Sd %SX TT)SL H5:S@ S8 3i"3f3& k3=3o32 13=)t3 $C)2222233P3<33l22433]2d2Q@/333333d4Dq2P~2P+/44,4P2:4i422222222 3333 0-LM KTPp@@QK09[$㬯<@in44 p-L M`Pvp@$ K@}2P0 h$<@Pl㐯!M P@ L㇯DBP 4 Kp5P5V5h5-5 p-LM`BPY0@0KpHM@@TxჁPPdV0 Hp@B8 K@ P (@P =555i5 -L MphBP!00KM`OPPp 0 \pP@8 K@(@ $` P p$ ᫃D;56i6 -@L,M( <K< K0p $0 K8i( S-L,R( M=i KU'6 0-LM(0 $0 0 ( K`6tp (@PP㾮( K$@ P %tpp @(0$ `pR$0 $0bS hG&gT hh@xi 36L6r6< p-L M@`PP  Kp ㄮ}g6 -L6 -LM K@N1P0 9 KxGp ܋K:[X 0`xpkKX0 K8:K5p` KЫ6_:5ii -LM KT@1PD0D DD0 K80 p$PK = j5i6 -LM KT@0PD0D DD0 K80 p$OKC v5i6 0-LM K$0 0 P  Ki5 0-L@8A P,0, ,,(?A `0665- 0-LM KP@p` `ŭX@ PH08 DD1[<80A `K0-66$5c- 0-LM KP@ph h㙭1[T㉭L@ P<0( 88Y$@ `K0---65 00@ S-La0@SW@A0@S=@X00 -L$M@ 0K00 K( 0 6 pOKi6 p-L$M`P@v@P iKKp< K\ DJQl P _04 65V5 -PLM  X@@KK ^ 80P0 K (gK?U 77 -L M KX@h/Px0@0K } p@@  ^N7< -LM>@>`P empPLPP0P0 0gt0@PUm`` PT0d0@ @@@@@g6d03/P27xo&&7,7M7(&7////0 L0L0/xo&0 T0T0/xo&0 \0\0/xo&0 D0D0/xo&0 d00d0/xo& 0-L@t{P 00000D S 0A0CS0(Pn0>S 0@0xo& -LQp0C)$0`0S/ R 0xo& -L)O9ɚ;6eA]9 -fML M@PZ0Pt6 e>K 0C C]pt&t T =@=PT`L'L=e>K 0CCP dVp x U 70S eP5N5d ]c^K @}^K @Β  R]>K 0CYt6pS PBx6S P:  @.P4 0x6 (6 R  + R  % R   0Sp60p6 5pWbp|  | a pp%オ{P Pp6S dLy!eK I IP%  0YBK00 %0 @B.K BdUK @RU.K Bop!UKA3LUK @BU.K Bop DQ |dcK IVd Ip($LDQ <d 0(4XY[UK @b>K0C@5 @0U.K BD5 ~oP@md  fKf.KP L H iopJ L |0P6 6|:BK d# @ۓBKX I0S:00c>K 0CBK! @#ʓBK I0S  2d c *d [03/6f.KH6 P $op HdO~Hp2p0S0S |6Sn2`pW 0 3/p K @⍑Q20-K BnKKp I!1QqPp"% & # y' thr' \cp#Pi% & _$ X$ Q [c0PpW 03/p|6 03/69AC) >)-&99":i/:~iK:S:@:xo&i;i;a:::4;L;C)C)iis9g9L Z;c;+Am;x;;; -L(MpP=`P '<P@( DKD Kp0S hߨ Lc*P400@ @Ө0 (¨K->tC)8i(>)>> -@L;`P0 P@p W㜀FF ~`P$ ᴍpT 5}@00  >>). ?tC)V p-@L M|;PPg00KpF@TF}`P <@ K刍P|u M?tC)] p-@L MO;PP0 |oF@(F}`P T@ K\P|u( Kp8@> ) ?tC)] -@LP;P0 |`0@#^:FpEh}pP "p8 N>,) ?tC)X?(&`? -@L M Kd*PT0T TTP0  RD @00>00K?5) ?tC) 0-LMP:P 0@ K@ @ @T Kh@ pT㤧L:P<:P,:PK0tC)7i?8@M?> p-L M@ ha  CP LaHPH` KP P ! ,aKpa@<?? -L,MP@Ph" (p-pPD"DN( LK LKBL Klp} ,P@# z@P5L K(@ lp <媋a<0 <0R a0):a 8a4PP) ptahahqhP < X1 \^ 0\4   Q0 TaQNa amP  Ki{! RSZ9a7aF `0P, R ` V 0P `PpP K-)-8i(~s>?~ ?)D)Ab?@ @ 0-@LP 1 K0hE -P@p`L0U0S! 8xP$P$P 40S040 0S 0S(0p(P8`0S$0(P{ P-LP`@ 8P VT08 9`P0`02 00 -LMPpP@`"00K 0K #  KP KC0P  0 p 0 `P0 -L M@PP00( 0Kd0 `PpQP00Z!V0"R0 "00"S(K20P 0, np 0 @0 -LM0 00 0pS 00BQ_ Qb0 K(PPP KLU YU U{P ,K⬀ &`4@V`T /@P00@ K+00 0P 0 0K KP30 R d00T` K)H0`S 0SVQ"00yUZ6 ZS08P08P Ur U0 0 K P!>T:KᬠKyv "10#Z 00 `@0K0 K0K墱P] 2BQX0AST00SOh2K:K8#<4:KᬠKPP&wPA ` P @BPyU/ 0 p( 0STc  PPG` 0!Ԥ Kv0 C0PK@T 0CS ,0K0 xC00K K`:T 0CS,0K0xC0 xRaD\W@DAD\7@D@S 00@D@ TSS0#B@,yTl pㆤ 7P.U< D 0p 0 00(K\ h@P+p@h55 -PL,M@`K@H  L0 pX) P W0 HL0P 00p0 HL0a0S PU LK㳢 4K㯢K|0SS  Q  R S0t0 p0 l0 h0 tKaT LK㐢 D)CHCUCQbC@LCCv&?D D_YD -p-P`L M0@ 0 0 0 SKp0C>S`!031 -LrP0@ ,W  WkU(&CEE5F 0-LM0K hǾPP \֜nL@P @ PP0K崾P020K0v&]D)~sPC-!Pp@` @ #@h,P$SPL080$60\ 000 0@0PDE(EP-`0\  H ^@0 6 0Q (0000DE(EP-H040#^0<\ 0000DE(EPD0 40#\00Q 00/00DE(EP@- @< :# T0 0^ 0000DE(EP@- @< 9# T0 0^ 0000DE(EP 4 <# \,4Q00/00DE(EP@- @ :# T 0^0P@d0 :0# TDD#^<0\ ,00$00DEAGUG(E -(0ML 00TP Kdv& -L Mp(K8P(@U` KKP` NP@ P 0-LM@PT0  (K9pK0ᘃI -0LnS@0oS@` `㈃Pp`tDPo0nS0oSbqPP]qPP& -LM q0 VSI(& -`@K~MMLⴐ─p 0 4UP(oXU  Vc0E Ÿ " P`0 kU0S 1PP`U aPXUQ0S 'P`| KU0SL \1PL\AU& X%K 0CC [pnK@94S}KS(pGi  PcB4p4SP @Pd< K@EP[d,K B4 !$4  0 0\d?o 2R0SP0S PSH4 SU S0S S K0@N^pj;´p` Ph P nn0SPpPE4SK AؿpL;MP0x#x#[S0ISʉ Ӂ`Q K1L-Q KM@D0C.K B0@0D00>K 0C(h[p0S SH )m80,00(ߖhORRRR 0-L@PeP88+P0K0hPPP -Ll Q=O P(& -pL M0 @`00 Q000 P嘠00 &Gp0@DTQ oP0 Tw|PD㋖e|A0(Ko;0D&0R.P -LMNKA>KM@D0C.K B0@0D00>K 0C(hZpQ0S SH Jl80,00(ANRRRR 0-L@PǪP8!8+ P0K0hPPP -L' N(&U -0@`LpP0 Fp00@DT oP0 {P{  tNA+tP T@+P,$,Ko0D&T.PPUP @-L;K[KM 0C PE (>K`@0( UZp 㴕3NV -L}k P'NW(& -P@`LM P r0 8P x" Fp,d2 0S00(0x`0&`0x01p0 )00`&0#0`e KZpS ^lP3 MP> 9P0 GP$ UP. gP0t0 sP mP$ oP0 @${P%08tP" uPp|00|0|00|00|00|0 0`xzP|Y0p00S0t0X0;;0x0UK6KGK$00|00|000(K0/XD& $V.P -LKK[KM @D PE>K.K 0C B@P800>K0C,|pYp0 hΔ< ,KK? @D < #<@0<$,0( <O7MrAPdWAX 0-@LM PKh7 0 B/oS" ? 0 㑔K0}X 0-L@XPK0h0m 0-L@\ZPK0h0 -L M@ K17 0R R0?S  ZKX 0-L@PP8>6+*P0:K0h5PPP -LMj40 0,0,0(0(0$00 0OLt\\Z\\(&\$\ 0-L@ P\0 0(0iPP0PLK0hhD) N -@L MH `p0 H 똧嘗 wDp70`FVQ 2@FP@܉D8PlЉ8DT<60S 0㋓ $6 60S 5 0<0U 4K@6400S0?S l08:%000x0000tU 4K!640P 00R0S H0@90;U 4K 640P 00R0S 0(80@00800K yPP+00       +  @  B ($ Rz$  $ Rq# , @ (     )            yx300  qx0$0000 lgx0 0000 H]x0$8000 $Sx0<:000 Ix08:000 ?x0@9000 5x0,0000 +x0000000 ox0909 R 4KG540P 00R0S 2Q 4K4540P 00R0S 0$0000 0kXQ 4K540P 00R0S p0,0Q 4K540P 00R0S $0 0P 4K440P 00R0S 00007000'+ (K8w&^w&D&F) ]F)0%]F)<]S]X.PF) j]p]y]]]]]]w&]]]^ -LJKRM$@D[KQ=KM`D(PE$0CQ-K00C`P0 Bq唁H00Q=K00Cp$pVpO0KSF04 C R@Q K< p0@040$nK?`F  !HP  0 Q=K$0C,PC.KP0 BDP'  4`$04<$ 04@04040 40$4 0(40,4044K K0 HパpJKD4 A KF)8[C^S^AP^ 0-L@PP8M3+9P0IK0hDPPP - LR R ?\_ -LM0@`Pp 0 /U000 fVPPK0P0 0 0K6V0 U0P f p-L M@0P$0 0`$K  TP0 ~]Kp 0`( "4`#/ p-L M`P@00   Pd00SPPP @@ 0*KKp F)[y_(0P0'0P0&0P0%0P02P0/ 0-@LBMPP' $ 40 00 0 00K000$0K 0 0P f< 8JH00K0K0ho꠆\} -LM`p@ Pp(K8#<0 00 D00 $$ #  <D Z00<804 40S0P,M0(00x0@E0 0J@dp P(H00@5P1 PD J F)l\_ -L$Mp@ D ` 2K@PKLP0IT0<000(K @0D3/X0p @" P*0 OJ0@ 3/p0< <0P1 0KK R0T#K#K e1#K P0R 0@ P#K@P#K_\ -LM⊏K`p/S ? P@1L#Pd8$#4d4# K(2 .D0@@ 0@?K0@0 xp$KPHBTd$ d 4KpE) -pL4M[ PL@@P :v@PpF(K` `LK 0L KD0 p\0Kb@P  P/@0   ``T \  X X R V0S`\0X0 X  X  XKip XK`P@X0 R !!D0D0X0V 0 000 0L c#!$c$"0 0@ 000<0E)__pE) -Ld IaGXa(& 0-LM K 0"0@0K0GP $̎Krw뮓Kaa -pPLM$ 0 \0 0P#c0#P 0P P # +?p20A0CS g@PhȝX00 00P0 Kp 8r,K 0 QtP e?t@ 6P!@K0 S Q  C 喓P   8w_ K,K! `P @K0 S Q $ pP    gP Kᮐp 00 \+K=Sp t 0S0娐S0夀SP P(K00D&ba`.Pbb2babfbbBbb -LMANK>K M@D0C.K B0@!=K(00>K 0C@(]Rp 㼍@8 <H>K 0C H>K0C H$S0P$(hH Q0P  (PGHGK4G(Gb cc(c9cWcucIcgc 0-@LM PK<0 0 B/oS" ? 0 eK0}X 0-L@QPK0h0m 0-L@0SPK0h0 -L M@ K0 0R R0?S  .KX 0-L@PḡP8/+P0K0h PPP 0`( "4`#/ 0-"44 0"44 04"40 @4"40LP $0 $((t XXpddhhllpptt0 0-"44 0"44LP0@ ᢤ៤ᜤDDᖤ@@ᐤHHኤLLPPT~TX{X\x`\ `p` p K0h -`@L"QU_@ 0-@LPXURO0 -P@L@`Ep@Q->C=->C6X3X\0\-9>,9>:>C'?n:>CF"?>CC>}C>GmFEnF E~G XJX ` p Q  $$((,S>,}S>GmFޣHHLLPPTTXX\\ -L M@Pp ! "44!1"441 $$((,,0044`TQ\50 S L5s`TpԐ}0  $0$S-Y`,⼨h(KTcT`X_X\[\`X`dUdhRhlNlpKptHtxExE Z <`9 6 $5 S\50 S` PP%@ PSڲ  4 4  TU 0`( "4`#/0+P0 C@ / p-MLM@R0 ANK4 @D8 P Ki7,`p`L0/X ^ 0$B$A KhF)XF)\F)xF)J)o -LM@oX10SP.@q0S41 4(! #0a Pᬇ 1 P000?>C?T00S Uᓇ 00$KቇzK$pG0* pPQ 0 S Y P01o0*hF)PF)J)J)XF)pF)J)d -LMD`p P ?#Kd00 @ؓ ` ̃0<0S  + 3 R d0  B  R\ ?0!.0S   d ?#K00 @ `0 < R2 00C0,0 ?SQ 0'B j ?ᅱ#K̟)#K0 000 \%H2R 00ß0 2",0KKKx ?b` @L<4 l0><d@ ?K D 0dᜁ0D00  R\!|04 \x P?(8,1傃0S U(`(pXQX`dPU1l 40 00 (Ko ٸ00S nppp0`<0 #<0VpPUP,ᶸJ)J)|F)U oJ)oTJ)T -L$MpfH < d_ @Pv `0 <460S  0 8 R 0Sx  ?X0I 08 S` `0 b8 ?0 RYQ4 4 UY0 4R0L4@oP' R\@$ 4  4 4  4L4 4 }A080ß4 0 0$5SCK00/0 @P!.CK@lQT0 @T@@ 0D@p`00C0 A@RP3@A00C0<0  0?00 @P@00030S\d 0@ `8?᩺08 ST0T00  B 08 SP5X@40 4 00<0 40S1ڨ0 Kd 0@ `8?$K{_@!P#@P$Kg4@4_,40 ?\<0< 00C000H R410S 1 1 1 dP 0E1 e0 < (K  ;A! A!4! !.H8@*4H0A80An C 00 0 FA@_0 F$0`0$0q4004000080P08 S`0/0 ό@P!. 1@R0 T@ @ @0`$ p,J)J)|F)U op;p(&J)w&epp x0-0`SLKPL L00S000000B0D0LF)w& -LHKM,@DKMDP`, p&60Q| S iDYP0\D00SLL0\D48KM?CP} /D͎` L ?Ġˌ(K8K=CM/B d004 60  00 0K C OL #p R0S000(KO/B P2(KN/B800#800(KM/B0MJ5@0S5 4t0K00,H08KPO?C0 X 0 `8KQ?C8KR?Cp%&` @V M8K=CX V  004#8KN?C0@K@,HA %8KQ?C8KR?C LH,,Ϡ3 \ß0 ^9    1?ppp QP L3= `pL04;0IaI 30d0 0KMA ?`p2 r018KM?C0(K0M/B0U P=I\8KM?C 20I4I8KM?C SK YP`p .D-D-D,D0?D 0\DD48KM?C 0)D0f D= ` pLd? $+4.D8K=C (K.B 0@(KM/B `4 KML0KML<$10LIH9 ( 0 8 $,4<1?!pppp0! 0= `pL04;$0 !IHL00tdp 0@ `Ì 0>IP(Kw&\F)J)x&z&DF)|F)TA -MLMh CK @4 H>n0S@ >pW<>@0 > ;0@@ 0`@ `> ៖PP 0 ,> ᓖHxH 0 D= ႖pP <=UP V ^P@ wV=P <}<0S (5,%0<<Q04ʴ w=0Qʘ o=댌,0 04 0A l a=040A L X=0 4Q, O=00 Q* F=00Q( ==004 Q 4=w;@ 00R0B \;\XYC*04p8@G  ?ᐶD ? `?]Zt`# 0`K 0 L? &H@,KN @N`=K@ 0C  0p@4`DH$呎2"0`S΅ ] E p_R`@L<(08@E.Kxp B-B-K B 0d$ d$8PŸS G K?A =K0C 0 0KA  GK?A   P0=K0C QP * ?  P0KA D4PD@4#'0SRE>K0C W=K0C$e0V- 00\4 \4P D4D@4#'0=K⠁ 0C⁎ᡑE>K0CP4EK/0 AE>K0CT4P$1>1\4 0GK AV [`L4 a3H4 QSQH4 S0100GK C AT4 0B P0 PP!@H4-K B? BD$p4嚂# d ?`֪U*PP1P#0KASD4UPKE AЀ 0 TJ  ?NB Q=K0C K R0A  0㼐妪p,\4  B!00BV!0`0Y3B11 T4S B!IKB AЀ?  KA P0}p,0\$B BQV`` aS2 0B0QaT4S :>s@帠``x Q0̈́ L0 E HPD4 PXŸL D4-  BQ  B!ʡ$%,PR`Sf`B `Q!a@ŔL     " R| D4P000E>C 0R4 0 01ビAp'Sx0<0(5002 0,%S00 5 \2P0\3aPPT``0 S p1\5?>C00!#4t x00T0 Pl0,% L1.1< 0  T=K0C) 0xF)J)J)w&w&pp0F)8F)q,qXqqqq4F)r/rrr`F)rJ)prF)w&,F)F)@F)DF)^F s>Fs\F)J)shF)pF)sXF)eHF)sx&ht@J)J)J)J)|F)J)J)TdF)&TsU LF).tJ)J)w&04 P L0h Ht tR 4  B @%LV.  R*h $! < ,! X 4! \ K 0CBK  @ x}B>K 0C+sV.ȯ 60S 0=S,϶0Sx0S0ӈ4 ,A,\t ^   ?d A a!1<80 '8 7BNK @Dp  $cCPP0D$0 t4 R0 St$ Bt$ St4 84 0,d4 }d 0 K A 0D4  aSpQ  }B>K 0C+BK A hPBK+ @bu-ᴠR㰡 , \ BQ 4 =S400T0 10⊠ಁX0\L TTR\ ?0 ` 0  B  R\ ?0  00C 0808 0B0 PB 4 B4R0x0``Tf8 0 RT,989 $5S0|9 @@90T90S 94 I9 dY04 s:04 ܵYz00@j TJ ๮H:0S  ?0dj0 HZ @T$ T*@pT$x0p 0Y\%lh_!h@PR  \@_ dŸ 0@{+Ì `0 8!;P@;\%R L;0S@=K 0C K 0 A L4`K\4 0L$,0Sژ L4Ph4 H4`l4 L4Ɵ#Lͅ EK@ P40P4 LKL 0R 0̱,\u@WL\`| a#Td|4 |4@D@\4S 40A{@W ?  R 0 (!|\0 pP\$$=Y $0T4 `0BXpQ<48$帀0x0 0Sx0xŨ0t\000B\Á0`  BYd Hh - Rhh   h ` lS2 0B0QÑdd 0R%~0  \$R 4|$0C04 4 S T4`R`   $%R l !P`   . R3d){ T4RT T  T4 RP%R X PP%PR$ d0|4 dQ|aQ |0 [Q$z  8 T P`?0Tt lR@Ό$00$020T$`S`0 0$5S V00 l1vaRP000\70S2dz0T$ST0T00! !0T$SP5RX0PP5PS|4 dP먐 P  0 P|4z00080`@0C40dƟ0400 T TR` ?0T  taR@ $00$0l0P0@hp`TS $S0`0S $uS0qpq0`VP@RلlpIӄPT40@'z8@`0xQ z@| 億 |4S|4P0CV`T4Pഄ4l0P0U:4lPh? ,h4呃\h4 Q \40I>K0CT4800yI>K0CЀ d?ğ 0L l 0 8@d4S30SD4d$0D4 D4S.4D48CD$3R|d3lhD?$hD$\Ő04\ \ @ ?d @_ @0 `>4< $4D40D4 t4Pz20Sʤ2\$0,00C0Sd4  20S 4D4S e4`20S dryd Y40D4 TC^K PE P20S AC 10S30304040403BVX*zQV.噫paV.HV⪲0S p=S,⛲L1?~ G?L 0 "0(qS 04 _ dLĒH 0@ `Ì014 00S0S 04 E0 d04 80>04>(KSohw&J)J)J)ThF)~ LtdF)\F)UtmtJ)|F)XF)J)J)J)J) -LMR`@p yPP xyq_K, K4"` P(KP(  4 >pc0S  T<08 (00,0 000040!04 04$0D0(0`P W h ` h20  t! h \ P D 4 >p  >p "y ıK]>p ᫭0P(a0CR4"`"f `)`aV-iPb 0  *0*0P0;b ש 0* *d@edAzd@ -PLCM M`B.KpP; Bgp@P E>K P0C)P<ULT!P0#  K 0-L@P9P8+P0K0hPPPR/ -LMԀ#K@ 0KQ`pX0P` I`0 X(Kf  ecK`p 80 80 -@LM P`p 0W0(08#8#48#8W00 T< !<04080? K :^FF^: -@LP`   ~ z -`@PL ((UX0 c#!$c4"X0C-bAYXQPYX QP#P0 -L,M#KP `Ȱ0 00K 60 0SC Q 0 wSS9 GS BS: 0XKS3 MS@kS- #bS, gS @ @ @V00 0Dt dsD0 8r@ 厰d"Q T@ D0U6WWQ QP 0 mS sS@V@@@@#KV0#K 0 `Lhw R0 ` ( 0 (Ke7eZe{ee -L+M,@ (42WT/(&wIft 00- @   L̨ 0 -0@vL xүPd`@D TB㔀#ᴐ000000`IB_O*N)P  /P P00P0S!bP P00P0S/ -X@LL`(VVP d0 P 6V0P \0<PO* 0P-L  C  vco`@wlx p-L MP@H`!00 V P@ vKpN*N)Fwx p-L M@\P`QH!40V P@ vKpN*N*N)Kwx -LMX1@0 PS)DP4aP0V Qp  1` P00 0 T :0S ԫ 0$KB>K0C+`\ $0K!00 S `8 #4`4# 0^ `$0K dᬫB>K0C+N*N)O*N*N*N)\w -L$M@` pP@>@0D >P0E1 0 1   tl?U*0 lt T;3 1X5: T8 HT0 84>`0>V01 S ~ 0@0 D?a @ 0d 6FPPEVs T$= Rlt U e2UPSQQ 0EH1 Q '1,}!0 S 00 8jS05< 01  10 ! V0J! $ ! 1 rP1 !$ LQ  E! !1 1 1  I ߩ  L!001 6 ҩ;(1  20740; 800V0@ $(P, <0DH 4 L`\```d`949 0T00;0KK50S0KK( $;PU ᫨P ?  00400L0 S1 / \P,  0p0B AKB``p`#QPAK``p0ᱝF0De$AT@h@hJ1CP@1:TP\PL9JPEP`,  n 0 1 d0p0(1 \00,1 12) @C$1 0H1 1 1 0$H81 1ZT:!hI !` R%"ʠƌ04! :C8 0P 0870 -( 0 ( *- 6  0TX 0 08崆Pp   X0SY,8ЀX0F 0\TsL0`0p\0f&1S (1S @P 1S ,1S811JQE1C1 `01 1$S1F01 1F01 1pp+I'X0 o4w0S= 0S h0S01 1 0C #0&, 6 Kp \8PP0 ?[R1 0 S10C1 P SN1\pP1`81 Fi S  JɌ0 01 Z1: D务! Z!:,6 6(01 1 M1 HGUㅢ 0! !0 S,6 0 5&p-(6X:40USL0S d0 gP Wڜ40Se`VvP1S 孛L0S d0 NP&  !#S 0+  1 Uۣ1&,"ԣ 0 B! 2(6H4幧 0! ժ60CU 00C0CSP: B 㰓0P1 11S0! "! {!d!$6Y:,6 0&<3Rp\".,hF  V!#0002!D,1`Pr820SDvpGpW@ ,20S8 H1,V +2QtRL0@S \0 Kc1p \: P6 D2 4 5p  4p o .K4p 0P(a0CR4"`"f `)`aV_Pb 0  *0*0P0X A 0* *d@edAzd@ -PLCM M`B.KpP; B*^p@P E>K P0C)P"3ULT!P0#  K 0`( "4`#/ -@0L` 0@9W <0h[ THs 0 'ZeA4 - Q0 . .< D08U*-@=B'a* -LD )_'}(& -@L` pv!>0P W0 0  +P` $Kk蛟:PP`0" 0Pn0S 8n0 .W 8U* 0d~}~ -@L QP=p@4 20<4ᾓI,K(0 0 Pk00?0 0<0P 0  0P00 0P 0P00<024 0 c PPXj~DPHPUPPᾓ  Q%400P0 0 0Up  W@d ” 2 `"R009: Ÿ^P`" 0 d' B X2p`VMP U ` 0 " 0 H(K0 H%!10MPE 1( K q嘁嘑nC#K 0 ;|!0S;0;T 0 MP0 <0 1Sa 0]WU;< 0& 0k 0VXk`관 0MP H `p( `pQ 0 P00;8U*a*ȀX*8X*(&8&W*V*`a*X`*6eɚ;H`*h`* -L$MP` @@p LZ"0S HK-$[2RP00$ 0@ - $@(K8U*X*" -L MP`0 @ 00 &0  $T $$ 0x   h0U 0L$ 0@$@7 ,(Koo(K8U*5SY@@a(& 80- 00RL(@@@0 %"a+. (& -L?PT@ P$ D$ 8$ ,$ $"(&LP -@L 0 R R p`  RQ\RP RPX0'R"R @00S S$P(& 0-L@Y P l00S\ 0@ !0R3 @00SP P990004a+,Da+ -P0L000`@?< 0S-0@ 1 0S !0 0C!0R3^0 :P 0*0 00 R@2(2022@220222222(2282P 0C^SBXX;$ 0@00=0#0%0WP/0Da+4a+,(&H -@P`L P0 SR 0SP0B0Q3 00@ 0  UDa+4a+,Xa+`@-0 @CT@ T00 P0S@v$0 x& -L`P@P  <ǙP:,E0 R4S /Q C0p R@P /QQ- ER .R$@P ERᙙP @D T0t/SP00/S00 /R/\ P1 R& 0-LJKSM,@DM<484@0(4?K4 ?0A4?4?4 4R=K0C@MP R=K0C0<4SI0.3.00N3R=K0C084S3SE7>`O|^ x>#l^夑 I00 4>3 S @@ 0T S S00 0=NK8R=K0C0D0S=R=K0C0K0ACl0R-K B Q K<4R-K B @84[h]O0S3/SaR=K0C0CQ=K K 0C @0@A[PPR-K BL :K00C$"u  u  u  R=K0C044S&  RKA<$84R=K0C0R-K8DR=K0C0 B 44$$0CR=K0C0C*R-K B0D S84R-K B Q K @<4?[0<[hS ;aS ?S DS .KK0AK KjKgR=K0C0KCdS eS cSK/| KoPR=K0C0C0 R=K0C0P C4  KC0@sS `pSa qSs lSK  KJR-K0P B0R=K0C0C @P :0S*0 0C!0R3 :0S0S  K0@ `PR=K 0C@R-K K B0@ K0@՛@ K0@ћR=K0C0@L4PR=K0C0P :K00CK R=K0C0P弛R=K0C0LR=K0CRMKP`@D3wS. xS vS`K⩛| KPPX`I$0SX X 4 PK◛@ KחPFR=K0C0C.@P0q QP 8 80S 8 00RKAA ^R=K0C0CKm K⭗P K0@ P 0R=K0C0h C!@X  K0@KO< K⏗@P 70S 7 &K9 KyP7'<07807L407007,07(07$07 0707070707 07070707Y!@2 PQ 08@PToR=K0C0C1 `P% *K0 B(h(&lX /0-0L@P 0P0 SR0h+ -0|@00/000 SLPXp ڤ? ;c0?+0?o f|0o0?h+, -0 ML@0 00@0K -LBM2`PUq qK_K Vn*X B/ᥗ0 S4(48#8IK,1 , IK⅓%K`d1@Q  P1b",4b4#04 40010S 0S Q0000 {00'{{gW0S0000R&*0S 0 0S 0 000R*Q l\0S H PY$K0PS A,a+Da+,,& p-L M@P`UP @TZ TTT0/  0?C!Q + <"Kpؖ(& 0-@L7"pP@ ({0@P0P0B"0f&  -L]MX3`0S HHADsDS0@#00450#00RSC 0#00%dp"& P?S"^V 0"00 00RSA 0"00tldp\"`DOP`@" 0,K1(A?40KKB 0$R$00PS : S PwPĖ4 V PPU(Kt|㰯1pPH eK /0v1V0e?Kq " cKeKe?K " ""#e?K #!@08l1 0K0CPPp/UU`   0P @T@ KU` @ /0-LP-@P@000/00@P 0S ꈚ -P/p`0L@oC 0T@@D$wQU pDP@DL|+ -PLllpP04@Sp+`P`\@0@0C0 VP4 $d`궚Hx+0, -Qp6LS`+@Pp10&(0C0T%Q&F( $06500nPPWVP   @$  (@/ၦ 0P0 @ PP\0`0@0 P $ Hx+0,ۚ1 0-L@΍04D00Hx+ 0-SL@ &0S 0S  0S `0 |P   T R 6!@0&F$ S 0S00BUrHx+ -L@`PP0S  0P0 @/P]ʎ0P 0 00讛 -LlM2P0 S 20SIt@P .X TL/0D`00`0p QP0*`p SR@*`qQgʔ0T \0 #K10 $K1\K $K1 0X 40 0Y0@ ^. pF K(K0 Y0`p  0 0/3Y`p$ Ktu0儠 00 0 0(p0 0KS0h0 0S0l0  0S0d0 $0S0`0 00 1S0K0 0`Da+&(&vĜ8a+,(8,,(a+C 0`( "4`#//4 <V5-43,Ꜻꊺ 0-LM|0@[Q0TX0Q L0LP   8K0Tꘜ,I8,(&h 0-P Lf8,(& -LMH0  Q0 0P ((P KhX~+8,(& -L M0Q 0@T0$R ||2 4ASAK  FKH0 KDP,( x`&Pa+X~+(&h&m  -LM0P0S 0 003/00S@x@ ?pK0 QPP0`PP],P 0,,BK0a+,h+Kx 0C SRIK A؀ATYX K @ ` 4 y    9a<98890S 4),8S H10S10S^ 4 =KU 0C CW) RYPER0PES L!UH1H0Ѩ PUJBK @LBK @HPEU,8S F)t4S 0t494W UBK @-PEX~+Pa+(&8a+8,  >ǟ`,> ݠ؃+h&G$,4a+W&x,,ˡ6U,Ђ+ -sL@M0 |5 xSX0㐣 R_PP) 4xSZ  4`S Q00P0S 30S -09$R U00V0SPV[05SJ R6 HXPU2 RR RH RI t|x20SLlPPHv  |%+0'p909909(K02 +"+R ! R   ?V0`Fei0+x0|5o909909PXxP pD  `0 PU xN 4S - P (  w 00 ?fpU00S x4S 90$;#;S %Px+XoX~+$,4a+&Q(&8,Ha+Ԓh&Da+nڢPa++ p-MLM7@0SWPP P P Kp6 PR60S 300P 60Se  "4"42i004488<<HHLLiiixx|]|i9^EiEi:^Ei"E4"4"24"42T0ASꐓA^K PESPl PK {Pet4 `Rd40S XX00i f c ` ]!  4"41V S" 4"4"24"4"24"4"24"42@ = : 7 4 1 +0$#$9? A $4 0? 1#04K0222020?"#3H0?%#?&3,0廂20j0 0%?"p200S" " l" R \bR@TSP"P :NH  D 8, $ )!0 x30000 1R 9? |#:? @  ?  ? A0 ?%8 ?&0 %0L0<040pe0!QP! PQ=0CS꜔0@$ 0  9-0CS    R0 R R00=0- 9 0 Tx^0Q,a+lT,Da+&4,k4a+h&IO  (&oOX~+أ$ -2BMLMP0000 00 Qa0S 0ASlԗ̗q封=0=P SR =0=00S BK@p0W" P;#;S ; 0``1r0@%S ) <40+C? R0 0B 0S XP 00S )\_\0SX@00S 000KDa+&X~+h&؃+P(&Pa+$,(a+,,a+7kT+8a+,,,1 ^¦q4a+Wħ,,, --LM    K(& 0-LMt0@0PS P j!0 <<PK0000S 0 K0hCT0 0 d Do-- 0-P8!P0L00@ P @P P P * P*@ P*@v q0  CSU # 3P R0C0000P:P1:P*B4 8#8S 0S@@D0ꀠ-4`00CS`0X  X0 X /x& -LMM? K @  3 K  @t K& -LDM`QpV |x@ PPKV201 0B?oR20t0@S00C00qp RpaV+ W1X. T T   lK} lKvh0 .$  lK} lKv.0\ dK?L rp W|4Sn(Kϰ-<8-& 0-LPM3@0S Q K0hN |31QllEdB00CSHHHHHHHHHHHtH"!<K0hK !0S SL )  d0AS&(8@P|HT HD@< 0S$K0h  4Kv1g0CS  /[20[0[3 [1[4[ K0hy'[20[(([3 [$)[4[ *[+[,[-[.[ /[0[1[$1jS!K "KQ Q PP{(v xSK0p-ܰ= *I[Xerp]ı;Cen -LDM@rb,PKX @%@H0K0 0 @0D0 "0@0 @@P0K DK<@ 8@ 4 0@ eP\p 4PPPp pPC@@P0K DKePPPP܁0S 0S HPP @㤡T:4(K0S 0L  /> 0:X #:0( 0S y S"010S00\0 5p.\|07S X|@(00SQ Z0@x0 `0 x`0P@PXT坨0S@%t--w~sp-Ӳ-p-|-{ P-L 0 9M(& -L MP3 `R#|P0p00* P P@ LP" P# P @@0 0xPW W W"0000 (K@@@00Z= "Z? e{ P0`F0Lp W aL^WLAL^7L\Q`  4PHH 0"U 0 00C0 )Y0K/ j0G?o P2 0 S H10 S p  (KoMPp/00:P W00S `PW _moPpP PP0 00   b_ B-$&-xxJ- -p@,PL`P xP@|& -0LS $  R R Kh Kh0  Yr-  -00ML 0$0 0 0> K胷 amP P P+ꢷ3 -L,M80KD K\S@3@#:@$KR 0 0-PLM   Q  ,XyrPK0  K@P .iPP wPxJr-r- 0-LM0Q8) @aDa!!T @$d@Oo@cc8##4P  ! "P  R P Q ,1rK0@T%<@ @%(T h X6%T @ ,+P" @$ "r-xJɷƷ÷Q @-.`pt0Pp@"/?0B!B`BBGQ R:0 0r-r- p-L M0@ `R  P.khP ,q0S ,qKp t0!PU U 0H <0Kph Kph0&r-xJr-Ϸ -L M@T T 0, ( KKhKh׷r-Q"!   0-RL@P TPK0h  (K0h0 K0h< -0LTM@h0 "0p d0 \ p@@l0K hK`@ X T@ ;bPlP p`P C@@@l0K hK(bPlPP唥V@|O(KP`0p  DX y R?x   :y0P t ?y't  PK\101 0!S00C00  QPP p0 Hg0 Lpa ,t tMl`00CS`0 X V0@T:(Ko{X0 X w0&\Qx& -LM005 K -LM0  * K -pL MP@aU QE4 0 -\P0 4 P Pp@@PE`FQ@@0S@p(K 0-L@M K0K0  K -L< Fظ(& -LK -AMLMa1p0W 0 0@P0"qaBK0x!x@CBKl@/*0P(4  0 L(1 0RC { a0$q00!1 /0R0 (!R (4Gf$@PzhcB(*_Bqh<T0 <0>U<Tl0 0d(0(PPK舣-(/1?E*^-(UϹ -LZ$뤨- 0-6LS F눣- 0-L+h(h%h|"hm/pd@P0" \oX4 i @e81s0 _K0hD-}- -L[ e(&-  p0000@0\0C0S @C |& -@PL00S8PU``84 #U:0X 00rX0X40P80 0X0`P -0- LM0@P 0 P0S* 0C 0K0 -LdMPP |Kv@PET |0[ S |Kih(K`pK |0 B0K/0K 0.`KK!| vK0 |0K  woT 0  .0, K V0B|K9P |K|v@X]|& -@`PL Mp尀(@ "!023 U 0 (Kpp p= (KL(P@T(0S0$P(    ( Kwqjqv -L(Ma H0 $0@0080000 0(0( $$0\̿(&{ -0-LM>`@ PXFP0 R D0D0=  $ 000K0@&=D--8- 0-PPL@ 7v0S S S0S00S0'vh K0h*S+S-S0SH00S vR0 0U0$00S0---'PD- -@LM` (0K^p K( p <PP pp(0K ^p Kix00Sl0 d7`(0X2TpT(0 @(0S @ D%` @L4-@&j8 0 R ( 000/  5ꜫ-8-@&-w -JMLM1p0S$=!dP@PJK0  @2u 04 c?4 4J.KKnK BJK0P`,1 B AI^p10S K;G~K pGX 4 uA7|4  K0A1$JKx$  $`0A.K0@p0 B @$D ?^pAud d4SDLD00S800SA.K$@--D--4-P -LMp10PS@p10Sd! RQT! RT  81(KocTST1 ba0S T (KoTQS ἐ张0HS T(KoB0  ;0S  4Q 0S , (KoT霫-4-<-&@&-=M? -LM@1`0pSP10S! Rk! RU  1 KicU KSUt1t l1X U  Ki^U4`0S) S S 0KlX0  0  U# Ki 1KlX1[    ,Kl"KX h \\ KiWUꜫ-4-<-&@&-=I-}5 -L$Mp2@ `RP T< 4 qP 1@$PK e@P<0K4 K\p#o Ks 8K e80KS Tw0Sg0Ss0S@,PK PU 10S@0S 00S#KSR 04 KU 0S 00SK1 QP 0, K00 00 t0 0 0lD-lI-<-- -LMb0PS@ T㠠 pA ,Kd)ms 0p Kpp`\p (K "0Y 0Sp >" @s0S @`K@`0K K/\po`V H10S<1 Rp 1 R 0 KkV 0S00S 0 K00[@K ,0K0 0dK0 KK0 0 0 0K0D 0dK0 K00xD-0B-<--_ -@1L0`SP1 pRp10S d10SX10SLL$KkM@10S! R? ! RT  1$KkaTST0 0ST $KkuTU@E@Ppx0GUT ` $KkT蜫--<----i4-&@&= -MLM2p0@S jYK,PET`P P@"@K9JK,@D q _` V:0@0E ![p2o(Kr  p0 V 9)K8 B r 9K80C"R0P S P!031 !`0T 10S1` `R00S 0*T 0S00S K0*,APjm`0 n  K,@@\m0 00_ D-<-<--  -L(M@0K #  , KZpSK00S  800S00S 0 ,K00S  @P,  0$`$p  0$(  0$ 0-<-4-= -LM`` KiW00 0 0$ K0"0K0tP01 $K0 @g PP$0K|@#@ @@ Zp$Kk  0R  D80W4000 @0 K\10S00S0@T 0!@0 pK0!0K0K<@0Sp倀|00SlFhph`E0S T 9 5@--<-x&34-= -LDM`PVp20S 0, K 0"0DK0p(tP ( D0D L0 L @PU(K0D0 (0H D0s(  H0K |Yp>(Ko( D`L0v(  0CH S  q7v*`p】倡D r00R0S X 0H00 @Kd@pK410S(10S. 0( rD0(`s ( o(V(L  L!L!L"L`00SP"!!!! , y-x&3-<-4-=   0-LMP0K #   KXpK0 0S  600S00S 0 Kd0 @RT0 L:0SK*RP /!K--<-4-@&J  0-L(M@0K #  $ KXpcK000S  6"K"KQQ 0 $KdQ X0,KP 0@Q0$-<-4-@&3R -LM!p PR 0p! R4 d! R0S( P10SD10S @40K@@ =Xp 4Z r`P ,0K# @@ ,Xp 4 00R  X  (K0J(Ko 00CS(4@D80(----<--_  -L$M@0K #  ( KWpK,0S  5x00Sl00S 0 (KH00S830 00$0(0*-<-4-=( -L(M0 80P0pS/0唐  :]Ph$KkdP`@ @HK-g$0K`0HK$0FU RT$K@&-H-D -L\MjPpBQ``$ 0@S P @0l K l0K_5000 0l|0K0P 'K0'KS R (KS @0l Kl0K PH-dt -lJML MP@i x 嘄 il,h|0pCoXrp  B$ c/ BW 4 $ T L,1VIK0 ,00JK@` V`{䋟0S k KZ0IK @0+; A0 @0 KZ @0+;JK0@|+`; TRT \;0S ,L @ IR@;@18 8Y00   /@ ,0`tpp0` ,W,WdȊ`p0pS , W, W딊p` ,t W,xd Wd`  ,D W,L4 W4l  , }W,  yWl  , qW, mWԉk  , eW, aW뤉k  , YW,t UWtj  ,T MW,pD IWDj  ,$ AW,D =Wi  ,5W,1W䈟i ,)W,%W봈hV BK0(  @+,|WBK, AhW\(}HQ x(|u 2Y 0'0'0'@e#44a0,8$0S RD 80YS? XQ!;}K pGX 4 l4aJ4 1B.K4 01`0p0 B0G Up;p4X10@soXpl7 0 "S00SX00Cs 60SX0@sY0p0p YP`0 0S- $ )$X 0,$R(0($R0@sp BKe 0崅 0 0 1 x&-4-=3-G i&0,--9J-a|@& -`LqMX? =P`jY@P U#*0T?SD0@0DTP.0p0.80>9p 80S"  0P>0Sr ` KXj00 SK0 帡 Qjc?K,ᬡ 尡 ǡK.YP 0 p`1 VXW p T=Y@P01 00A AgP  Ta  ,Y0P1 00001 vgP,Z =z-  =0S=T` Ij mK1pT ( 0S8j0SaDgPZp:gP,T 3gP .gP01  &gP01  tgP dgP01  HgP  0 ,g PT ! i!mK ῧ1 T  0Si0S f P$T ! i!mK >lw?K1T l i0Si0Sw?K0!QP10 yfP:TX A 1 Rm aBQ'0 p p p p p p @ H p p p p p P X p | p p ` p  h 01 <  ! p   31/XT W 0HS񟗤 d  4  Ri mK k1`Tp  0S@i0S0!QP >K0 1` Sa 00  x 0H0u8X(  i mK k1`Tp 0S i0SWV 01Kq?K0C0 1` S01 aV@ d dV*, h mK `1coKT ~0Sh0S `  +K1S0 uW<X 1Sxl  01 X0S@]AT 0H?oT20S0H?oT20S0H?oT20X0S @X< 1sXp0 ;p01 RP.00%800% 9018@ |P  KW`1nOKU01 1Sh&1 01Z, K10   !`01 00K0 K0SK AQpCh  ! c/! 4SK @5k/K Q4p8 1 {450S (50S5" 5 (K 0PP40S 0 GKg 0t1 c?joK1 p`4i/KGKPpH30SX Kg, K0A1 @K  `0@1 0 0GKp Ppg x30S30S000CS##1" = TV@P 3porlc0S tY00d3_oK1 01 c?1 40q?K0o?K0-K\3 rPp9X|f RT=00D@ j_P0=S "8 R0  \_P 0=S] !8 R 0Y  |N_P 0=S !8 R  HD!TPPW@210@0W1@2@,,q0S 00S~U( P X-i p 0xq 01P01 0D08/00PEU, L " L # L 1000!-R&@&@-_VR D-x@_>M',,J`hJC 3u,G-4-b -u3,-&9P - P2-0SQ C㘡 šKơKf eK.0 QPF f0"S f 70 SE1T R +00S/ S! S0 F1 0Cs! " (0"0g/K1 K f?K iOpX)R F0001K0q/KqK1  BA0 K1 aKUf0S<@@T T T40g/K000@.K &@q/K0 B@00q/K0 B00 K0`0}0a/K00aQ@PY KpP>K Op X(Koe0S0 0180 0L 0100001s_[ -LP@   x l ` T H < 0C(& %8Y x00-@LTP`b P  p@00@m Ԯ-  -LMM @AK@P (,AK@PK< p-LIM M PAK` @POKpKKAKA @P4 Dy4 |>yx@0S0S AK @0S0 0S AK AP<Ԯ- -LMM @AK@PHK40 R AK A}P<Ԯ- -3MLMpNK@D'PPXY{ ZP0(8K a`PP ) aP bHPP  XHPx2  (d NH`P_ L2P DaP ,ESPP0 04U,00P`+0SxCW K1!P@K@PP ~xK@1!@P`10S T< a0z <`aPPqEWP! P 0 V_3KAPh\`ZZE_oR0 0P  (8[S K@NP t(x50 `P<jmԮ-wI a(&C@ -LlMx t @p0 {PPXk(KB>.0P`0 4  ` ipP*U  wTa Te Ti;L0 7WT0 00 w_H p0 ?oR20Sd0 0\0  `0@` 0\0 @T\*x7P0p7p' 0l7\0d7d0H0#``P pWP*p0S 0P S?%KP0kჄኤ  PGP@ 0<Kp X0P4;0 DKp D K<K`16L0 6VT0 1L0 |6|VT0 0SLKHK#\6PT0 0L0 ,6DVT0 _\0BnS01\0 x0S 0t S@P0 @ 0P0 d0S6 0S3L P?^ H0\L0KI?Ġ&K^?| &K^0l 0^@ PZ 0 5j| l Bnb0 P04 0P0DKrp ?4 P$;<Kbp  0I P$ P$4K;Sp D0K 0\H0@O00@ P 0= 3 4 K<KL@X0P_ 0,^ 0 &^ T0%/0SR P0Ëე0S?%KP0 @C% p `Sp`P 0DKp X04$;<Kp ?4$;4Kp 40K< KDKL`X0 0] P0 ]T00? 0]T00T 0PXP0劄;d0 P04T0 0S;  PAD`KP@T d0p> ?4K0CCnCKa0S <0Upp2.KK B@xP.KK B@p@PKA "uK0M-W<3 -`PpL@Q0  0 ^PP RX$0S D$P 0X0( 0$ 0&4".L&.*.-- -L4800S ,0 0$p  H (".4".- @T0-L@4@00SS(,0 $0R  K(+ . "..*.- -MpQL MK0CBK0C+A#?P @0($@0u K0$$[000nS ?S aS pS qS@x0 |@Y@h0 d@Q P0L p0 8D4".x&h-x&.-,$00S 00S/-. d0- LR L00S 08P8@p`0Pp`00h-(".-. -RLpM@  Td \ R Q ğ@ R@S1 4P @ @@   R0TdTt@D^ Q 0 R R\* 0BS0@00S 0@ K0 S 3^ \000lPU5P0S@K $\ \\!\ 0P0U`^ 1EK $Pl P$PV^K H 0\ \0\ 0K0$0[U " \U $U``` 0\D 1LK$\0 lH` PCQy A0'\0" P $Q  \,\Q ]\(A  0\ D R \? ]\B} `K1L $`VJ lPH` CR B0 pp\\ $\PPP 0QD K1A$\ lH` PCQ A0Qpp0\0C\\\ QppP0,\ ]\ |&x&<-8&.8".x .4". P-@@P@TL @.|`| |P2S@dĜ \0 TP P00@ <$0@Kh}&~ 4".A0L&.H*.  P  -PL0S0@0`x0Qh%pW 0L 0S @?"Pp`R 6"--,-&.l*. P-L. 0 Kh2L&.J P-L . 0 Kh"L&.= P-L- 0 KhL&.Q P0-L(@ -0000  L&.4".h-W P0-L(@ -0000 L&.4".-x P0-L(@ -0000 L&.4".H- p-AMPLM0  4 0@0 4@S$ - 81 KpS@ 4SA>K 0C!CC<P 4S$4?PP $4T00aS` 0` 0R`T0 0 0@00@@AK @ @$4 Q000S0'GA>K 0C4 CCm<P L&.-. ". -1ML MX P\ ?- <4 KP>K0C $CCJ<P @4@^1`  PY30S Sc \ +7@PQ`I13 @cX<S0S 3PUd30S5 \<P/ T3\0K0D3 0@ ,3,(3Q\<RQ300?o2V'Q20S  2p \<P0002p@\< \<R R00 R P 42L"0K0$2 0@ 2 2QT100?o2'\,Qw10Ss 1@P0001@f, Kr\\ >K PQP<S\<TpK8@\qU Q 0S 0S1 \<QP, 0BK0 000@r 00QQ000?o2&Q|00S  d0 \<(P000<0PL&.h-7 - "..4- "..--(".T*. -KMPLM4 0 4 0@04@S , p 2 (KS5 4SK K! A@;P 4S4_>PP T0  1 1 0 00BK @Z`' P1 pW D1DK K0! A@:PKK HHIZp$P[0S p)04 R000S04 P(0t0P460 QP #R0pm|L&.T*. "..P-4".N.?0 0 00 P.D0 0 00 E.D -KML M P U+ 2 KP=K0Cl"CC`:P @L2@H204 48XP (2 0SD 2~ ^/ P4 !aQ0S 10S 00 "5@P@/p1@0S J7PX1 l'4P H1H!0BK0<1 0@ 4pS KKHHpP,00 0 00T   /o" 'l0Q00S 0@4P000`0@\L&.Gh-.TP-4".7 - "..<-[ ".T*..D-?(".N -PLAM@ * 0 KpP0 A^K PE `E |Rx0` 0l0l``0+<9Pk4[S P0 CL&.4".W.D 0P/SI P0-L0@H*0000 i0L&.4". P-L@PS/o" P`P0U0 p0d0d{PU @0<0 *$0 Q00 +S4".I 0- L 0.L&. P-L) ,0 $00S0 Kh,L&.,-4". 0- L 0-L&. P-L` Q!0?o20@0`Q  0S 0 0S P )00@xP T0 LP80 6P400 0L&.t .I4".S5".Kz. 0- L8 0a,-L&. 0- L, 0n.L&. 0-,@,0 L 00S 0 0.L&.t . 0- L 0-L&. P00P0-SL MP(a 2)00 KAP0q?oѣ2P%P00\0 Q R`000nP ,0QP9`0P0 0R0@00,\  ,L&.-".S4".I -0- 0- L 04-L&. 0- L 0 4-L&.P00P0 S-Lp@ (00PP-`P 0 `0 S   S  0S00hPL05P < 0?o20L&.4".S-.IB( P00P0-SLM   i( 0 KP KKv7P 0dPd00}S`00S T0T嚖0HRP 40 0, 0( 0L&.`,-4".q$".0-!. 0P0-L P000:@P00p lNK0hP K0h( 4@ 0S80 0300SL&.0-<-4". P00P0-SLM   ' L0 KP8 KK6P 0 P0 L&.$". p-LM P$ ' D1 KpP0!$K K6P @1@+( fP$0 @` $1PP(+0P0$ S0 0S P P l0 Q\00S  L0P $0pP000$0PL&.Gh-7 -$".(".- -LM P d' 0 KP 0Sx KKn6P 0S0TYP0@SP00 ( KKV6PL&. $". -L MP@ppGoᩒ PwTPK10Sc1(KojQPQNpW|g)PPtQ h1RPRpq7|0@ 0.OP0 001#CTP 0|S ]9@P 0 T% (KoP @T $T 0P`0`TT TP0 T& <0 (KT08` P-4".&\QYL&._SM! -L M( P, & 2 KPN(0S!,K(K5P (0, 1C  0  SP 00|S 8P jP ,0tS@h1$ d@*4 PP @4Q0ESAK+ @n>@ 0 K~ <$". -LM P $ <0 KP( KK+3P   L&. -LM P $ <0 KP( KK 3P   L&. -LM P # p0 KP 0SP KK2P 0S0, KK2PL&.V P0-L# @0 0 40PP@  P0L&.,-  0@S0-L# @0 0 40PP@  P0L&.,-% P0-L~# @0 0 40PP@  }P0xL&.,-27P P-L \# (0 00S^ Kh,L&..?P Q0-L B# H0 0@0 @R 0S L&.. -L 0-PL M0K00P0S # L0 KP@ 4@P@K$N RL&.D p-L$M0 P4 " 1 KpP!4K0K2P 40#p8 `1`,80SD1H 80 0S(10 $~P&`80 0S 0@T 0&@LPPN e &780(@K J4800@ 0@3/P00S L0H  0_&L&.4".Mbu- 8 .p-j*. 0- L< 0T*.L&. 0- L0 0d*.L&. P-@@P@TLPp U"00Pl`h0h@嚐00 0D00oJU00@ $KkdJL&..4".8&.<- 0-PLMA  0P00o00K0P"0P%0S0P 00@0@0S 0 S  @@@00+T%J0 S +<J4 KK1PL&. ".4".. ".8".x . P0-LP 0?o20 0P !000@+P 0 00x@0t tS00Pd \0DP(0 4 P0 L&.-<-SI4". 40-0, SL$00T 00 ,-(-L&.!. 40-0, SL$00? 00 ,-x.&L&.,". 0-@PLK0h 0- L# 08-L&. 0- L 0E.L&. -PL M@PpoRZPY`TPQ Y.PbTJ S.@PP[^%Z% UL1H1@W <10S 01$!1 0S ! 5 U10@W 00S 0 0 0S   "% %`PKP`pCP `>P L9P` (K".X*.,-4".SIT".".Wy -Lp0L&. P-L x0 pP \00}ST00S H0H@P 00 0( 0$ 0L&.,-4".$".0-!. P00P0p-SL M` z 0 Kp0@ 0S PP KSP0 00S  L 0奎 zL&.P-4"..: P0-LA $0 00@P0CP0L&.,-j -LM0 P4 ) T2 qLR0S@2@nP:00S 20S 2`@b40 l 7H衟P0@c"`! !    @`#! 0X0CQ00CS0G-  PJ00CS0K$  PBX!4K0K.PS0 8  pp8  00p(K0pp Wp0a, P 000 XP00d0I00H0 0 Sp(0Lx0 0 SL&.-4".o--x&<-<- P00P0p-SLM` $  v00KpPp $K K.P $0<*0 QP@P @$0( $0T000L&.04". P00P0p-SLM@( ,  @00KpP ,K(KN.P ,0\*0 QPK H0$KP,0`* 0(H"KR000L&.4".9 P-L 00 P Kh Kh L&.?D 800- L@P00 K0h4".L P00P0-SL M쀟( ,  00 KP ,K(K-P ,0<1pP !PPP 0RPJ@J@"/` F H8 800L&.Y~ P00P0-SLM0 4   0 (KP 4K0K-P @P@ 0R@UJ`.|0P 0F0pp`p@p00004 0 D0@  ? <L&.Yt ..,-D? P-L@Pp >00`P P P@K+p0 ` S PH@@ @000 (;0L&.}8 4".0".. -Lp`PR @P h0hKh P 00|.8 0 RU Kh 4".,- 0- LMPP  R KhPX@X`Xp0S00K 8R  @L&.H&4". 0P-Lp @ KhPPP` HKhP |00 00L&.4".  P0-L~ L0 0D00S808K0h0$@$P0vP0L&.P-4".,-G 0@S0-L[ h0 0`00ST0TK0h蝋 @0PP@ ,PP0KL&.P-4".L,-y~ 0@S0- L/ l0 0d00SX0XK0hqD0PP@,#P0 L&.P-4".,-0@-@CT @ T00 P0S@0  -LZKM,PE,MPQ  3 (KP#EE+P @3`p尓W 3  㘔!DP@*tD0A-K B00`A=K0C A-K B,3 A-K B 30A-K @ B100S  2@0 00@Ђ0S0Ă?00/ppV"Պp"p0S@$S \SE00H@0S@D"  p  @#0pC  BR0! B D0 1HiQ0@SAK A0! BpDA-K B0 H0A-K B00P,1D| 1 R ! R0 ! R Ԡf  E  =D  2/ R 0S l0*\'D00000mA=K0C0S 0`S9L&.--4".p-|&h*.Mp .b.,-.. 0-@LP 00P 00P0000  -l0LhM X00S H 0dpK P00pK0p U.(".4".- -LhMT00S D 0dpK P,0pK0p  3(".64".- -@LQGPp `0 0C0S13  +\P0 S 0C0SL13P  0 0C0S13 P -`LP@::P [ 0S1PS !QtKhr+`)P %9P00 4<S!0RPoY 0-@LP 00PU F JP00000@-@CT @ T00 P0S@0 P0@-00S@0\0%\#0S P   R   0W7 0C200W70 0C0|& -LMPP@px lW[P P01X2 0S# 4F[P0 0012 9[P0 0  ^](K/ 29P0 A *`@)9P 0S |1` *:`9P *hP d: 9P`- 00``( 0K;0S 000S0 @Rđ0 N^ @ 8 |*8  `;B 0S00000 0*X *PUy D0P*dD-\*..D p-L M`P0@P< 0K*(0St 0l R0 0  ]Kp B 0 R00S 0C0S130 p . 0-@!MLM48 >K 0C XP8H K p \8S 0S @HT 0S ]@! KKw(K8Pg 0Sd ;]`P` P P tPd] T]00@HT 0S 8HT 0S /]T4(RK@lA놮K@J48T C/o" R ]$PUp 4( B0pPZ P PU l 3PPTp pW @3pp00$0Q` h8 h80BnK `F+*A@(<P( QL( L 3H(  KAl( h8 Th *l(h8 R.<(3R @t~048 b)@@ 7P @@8\8 (3@W)@ :@7P 00N)8 fP  @z@wRX(\@J)P X X<  KAZ %  R5 h4(R /g7P  4(R R +@ KAL( Th P R0S10}S庆KACZTO RL U K+  @@K+8 @2K+ @2NK @D+Du@ 0Th PH L( (Q $1@p R  +c@KATh p0@@DcT@@0P/\P0H8 0KSL A @) >D4-^..-+e$".xL&.(&W.-Tf. -bMLM(    t $ `       VKK L   x  |     d h l   5     0% sP:]K[>K 0C (p1 A(l |>(h x;(tEV>K! 0CTd `E ! P 0S P(xP 0S#T(  T\>0S(L[$6S 6S6S6S5S6s ' =0S5  /[P' '=5S 50St5S(x  0hMh 0 SK A AK A 8=0S ]K PEP' t5Sk=- i 5S 5MK @Dp5P=K 0C<<  p%?P0\ )X<0S'L< R*  ,5 R4$?DP<5 - 50|S)    5S;5  OL%x; < 7%R %SRl  S`  ;T+u 5S 50S =K, 少0P 0S| -' PzB`]K@oG@P@ 0S :ZPUhBV :FMW@PU gF 6St5S 6S` : 0L U5%P E%;5P 0, K " BP5 T5 X5 1[>Kp L50X5S 0S PET& 0S CP  qZUK@_ 00=K 0C C @0S 50S P @ 0P5 (&P  KAUKKN00Pt5 KSU ]^K @ PEE|eE8,K0 B5 05 ]>K]b0P S0Fq0 h%ZPV 6SZ|%HZ_oaU0PE(h(xTP na 0N^K PE0P0C.KG\Pl70S ;PPN.K BCK@ CK= =50S 0N>K 0CC.KH60 S00?o2$PPF P< P<D60S"UFT$x%K*ex巃p崃 0) G\孃 P @@6(&,x5@T =K10%5j@x%eVK A50S U8 P5%S %5QJFu6弅S`el5T,UPX 40S 5 @1@ 0,V \40S 5 !@ T @=~5p `30S 5,5K 0C 0C 0K0[>K 0C0-K=K 0C B(P= P6 P 35SMP@S>K 0C SR P0S>K 0C@C0 UT2 SR P0 20S0 6 300  00 p`S>K 0C SR@Ÿ UT%( 5S435  1$ R2"u=2R P =1B$220c>K0C6S o06 ~4BVU %kwPcXeD0K0 A,0&PR WD0"0C?o2? PD"0 0A@06 6 R ;R RAPj d06 6 R R-).=....|,-.\Q&Py#D-".F+q_ p .D.8-A_Ns`d \ i -6Xk}".`t .o..".4".#.U [nKP0 `F0Sa R?0  F6S F?U F F FR0tF0\0 F5 <pPD5P@P 00S5@@@3%01R!mK `F SR R^K PE !5E 3/E px1@ ]1 R01ZK@  FRF5 H2W<;@20S @20S@0 6S PEU0S2 }K pGYK@kGY>K 0C CP 0PZ R= 0 R0= `  #2c.K0 B cKAR0 `3&U00R0S5 P6S6SVP%uP?P~U B30SB3P0=33 ?P0 4 0 #,快Y|%H$   s5S-4%0R/ KVK @[K @][K[5S F05 6S ?06 5S 805 5S 105 (K5S 53/5S  05  0-L@RP  RP0 K0h+%PP  pRP 0 EXM P`P 0S  (R0P K0hKB -PLAM MAK(LA-K0 BAKJK,L0,@DA-KP B4@PB 0P (K ,D4֫,0P R 5000@ :K,0C4K"p`JK,@DA=K(0CA-K$ BP8Z A K@0@.P 4D0RD4P0400S Z Z pA KL@0PE A K8@ P 00*S0 AK A+DP0,0-SAK A0DP0 P0,00000 /R0 *R0 ,DDP0,000000SD3 08~UEA-KA K4 B$@0P A=K40C0A K0, @$AA K @Ps 0 00SnA K@gA=K00C0fA K@P 0!`\A Kx@P A Kd@P T@UMA KH@P87UC0 000=A K@yP A K@sP1 P 00 q!'A K@cP U KUU U WI Ut1U 0UV 0S Lv 1 0<q W3 0$!0STW& 0U0S 0 0 A K,@0  0S 0 TTV j|&`.p<.J2FL1^ -,-4". 0-LM, ( d 0 $0 P L10S 0S$00 0 Ku raQ @T$0, S 00S 0s $0( :.P 0( S00$0@xp @T hc=P 0|S 00 0S$00 0 $00$0 ..! ! -..\Q -`L$M@@KP 8000 04@ (0 ,0 r pD ;0P/S:S X;@?  D 7 DD*P% 07DP/4@ "T@P/:TpP S@D,P  K@7 /0, 00P0DK=@PU@P04K00 l0@@DcT@@ , 4K00 <0@0CcS1S@xDyL&. 0-L? (0@  000?@0. -  t0-L ~`00S T0 0Lp `8 00000$ 0 0.(".4".--h- -  -\0LhM Td DpK]7<0 0pK0s 5 .,4".-00CS0 S0 S0 / @-0LhM@"0 0 00 0rS sS t2d hpK7d \pK&)T0 0pK0s ,d $.h- -.gX4".-a -LTM@p  T?t x &K%K+  ?&KXRT LK)>&K`%K`%KR0T b<K$KKP 04DPZ R= 0 R0Fd `@ 0KP %KptP(>0S >0#S >0PS H1 R KR00A#P M.>yP v(K  `p 0 %K R0%Kp x]`P>0S >0#SIY0S KP0 R0 .} #%KK 0%K.@B4". p-LM`PP@ @0BKs8#8,0 U 0 Ks8#8000@?,K lP V[U 0KA0T00Kp 0-L(> x0@ h00S \0 0Tp @ 000400S $ >@0.(".4". --- 0-L=@d00S X0 0Pp < 000000S  [=@0(".4".--- -@06BML M@ 6D @8 6V44 -0W S00G00@4S8BK+ A(y5<4S `04V @40@4 04S004 S<400CS0s@P񟗯 $ $ 0 x400CS0 ^0h `?-0 400CS0G00 s`93`3sPD4S 300  8 00(K@|3@T30S VU@@8SH3H!\-4380 V S$ " R 5X Q Q#Q V RV"| H4 ƾH4`"H4 zH4V l" 0 C " T BQ@Rd@T Z " @ S)S 4  @ !4@Q 105 24$ 5T dT(S@V-S<$R  <$ <$ X- KW05p20 00d1X 1 b8q n 0VR08 0QQ00R0S 1/d0 d0YY00R0S 9/0H40St00S BK @3/ -- H -L&.p .|.,-$-4".P&.*.3-t*.l-6|&-- --LMP@T P 0 K0p0 ` l#zd, \0\ 9o+0@VS 6/*.L&. - o-? -@FML M` tD ; ;F>K 0C ;0p4 l3G.K0l4 F>K 0C 0ChD W0P S ; 0 O 3 Wx4,Q32"xD࢟ 4 T  O 2x V 0 PE~K0Pp2C.KQP t"tCK3 d~30S x40S @0C.K8l PP CKk@0S00?o 2Piꐑ  30@x0V0 P4 `14 xD pp4 d?41pIP$ 0S004 0 0C>KY= a 80@PSp  OP P  0 0S 4 x04P00F>K 0C0C,h%4(K--".L&.-l-,-+4"._q|.*.G[ -Dg0JMLM4 p(GW$W g  r3 70S00p   P 幣W 6 V3 P妣|60 0 0dK>K0ScP6P0S. DpW*868&0S0(0$  \$Q0 P R%4 i4 R % BR5x00:0S P(0S5 p5rxp`00S04 B>K 0C0C0J>K0C0B>K 0C0C0B>K 0C0CC.K Pd 4 5pW ;0000R4Ax40pC WSYt4I>K 0C C0C 0F>K 0C00F>K 0C00F>K 0C X C< P4D 49!>p$0d4[hK0S  K>K p塢K TPP20 0 08K>K $ G9J.K Bpl 40PLx0X[ Sq:10S: 0S6 xJK 2 0IK [1C.KJKOP"hC.K04 P10S00 0%4S0 P 0S1!40S Z 000S 0 0S| Z0s0p0K Z]W  SW04 0 0K>K7N- -..-m.(-.!.-,-4".P&.jL&.E-y<- 1C(--. -LHM`1ApWk pPH  pB 0\0 0TK5KԅKl1Q< ?%KDKK$KP<LPZ= X  /\Kp80S 圡0$K0@0( 4Kpp80S PL00 p~p 30[S $0K< #   |$K-.p .s-P 0-\b@LT0V H2T R ,B ^$2 2pQ ,800 E00 E0 A0 A01 R$!$! 1 (!(! 1 ,!,! 1 0!0! p1 4!4! `1 8!8! P1 P(00S64*.-L&. %|. 00-tDL M(  0 , 0 0 4P@ D4D$@4Q00 44@T (40S@ 40S@@40SPm30S3tc 3 33tK030SP J`"PDT L3 00 ,4mP@-s)-000 3 &( [PP#B000 s 0t0( 00_>P a d6P T@P T 8P 2,@h32P0 S R0S S @T 1Qo0S@T( tP 0S ( <PD10S 0 $10S1o10S 0 P %#00S 00Szߞ 40 ?.--`*.-.4".dL&..-|-ȼ .a--l ".--|. -LM (   K (   ''' ' RS 7Q $K00-S0S 7 }x7 xwl7h70S>00 0 0 L7H0 PPP<N0S 03/00 @@ \2 R0P*40 S[1#t$ԌK ?,KT K R000@ T.00@ 00@   0` Vq   00CS0p`,KP00 y0#t 0S 03/|"..N...,- ".4".----d 4 \Qx&.L&..yP`Da$".<0".-t .". -LBM$1 0! ,, @ 1 _1 NK@P , 0 ,<@@P@;0 1 ;0 1 y0o 0S>;0SV0+1 1 R0 000 0 PKPNx<p90 STO0P 10|S qP/RG@*30SR &30 SN  ): 0RS 0S 10-S1S :!:!0S !$K0S L: 1Si0Sj0JP001Sd1Sh9! 9 ! 9T001S  T T/00P90S 20 SPh \90S 20 S P $90S9Q0SP PP80S1S"Z&(P  88(l80sSp8  d=Px10S !<2Pm0s 1SP 7 7 R0ZW0SB|Y/P 7 1 <7 <7 1Kp 1p 0: S0&0&0`7 R,T7T'TT+10|S  ,  1Sp6 l6 61 $  1S66 R P |6F 60SP 50S 5 R05P50S 40CS10S 5  p )P0峚1%p1 1q 15P00 8(PO10 SH41S 1 3/0 1 X 0Sl4 RQ 0T40S !4Rh 0 QPK K⥽.K,K0K0 ܼps4K@Q弮  0hIg\OPHI0Sc!00CS0Kp@b T000  T$C<C 0 0 0 0RP`pk V00 0 0DP^ !00CS0 pT P `p !0`#Y!܎K0 ?.KЀU KX0 0 !00CS0@ T0S* 10@ U.10@ 00 S61 10@- v!0@  kT< mt{j ]!0@k.K@T01 J#Gl哙@ `儲TnK @00S /z v 1S 1 3/9"..?...?4- ".d*.--d 4 \Q,-4".L&..D1 ..-<-.a&. yP`-t .".?Tl /0Kn4".P P0-LdP X0 00IT0 @P$ 0 K0h |.L&. -L0 㓯v(&0@-@CT @ T00 P0S@q0  -p@0`LPPP P@@& 0-X@L0SHP40 0R X 0 -R- 0-X@L4SHP44 0R 9 0 --PC-! 0`Pxp^ Y @Y X BR`P0Q 舎& -L$M`@pl{,T PT#(KT <<@DT0@0 pP@0  P' 40 P0Q 0`&@Pr !0S 0TS yj@X 80K @0 '@0,K0! 03/0 00 T4".Rn ".! #&0@-0 P$R!R!\6 \> 0 Q Q Q 0 T1 R   R  41 0 Q 'Q Q5S S 0 Q Q 00 !R0@0 0"Q \Q Q@T "T0@0.8-*..& h0h - `0` `@ X0L P0 P w`V000.p-8-..*.h*. -aLM0AS ol0 S tA0*\\ PT 8 8  0S  <Nlq0S 00pP U 0S 00S 08K  &0 03/00S 0S  \0R TL (K(".4".?p-x&.h*.Mb... ! ! P/ 0-@PL(P 0x -LOMOOKP`P50`V4pPZ V0`p=  5! 0 S?K4 ЀX00#P  S?K LQ?KY$X40$ KK 0t$嚮S?K@` P  (4Y$$ KK  0d$倮@Y KKd 0#o@<K?KP <dP1 # ^0@Q/K`P  S  RS0K/KH#d1@# 01`pV0 `Vp`p`pd#삟/ ` 0p&%@1+ / 0 QK``p&5;G% 0" U@m D2`V0hSK 0Pa L2ЀX0\<2  0X0SX72S?K I 0 DS?K m`pmK?K`!d٭W@ KKd0X!Э@<K?K<pTd 0D!῭O?K`@!4`VApQVX0K?Kd 姭 @K?K d࡭U 00p KKY(KQ?KQK 40D!@"% +LŠD! @ 0(-.A.U.Q..#4". 0-D@L0s,00p ܚ0Co0&4".00S000/h,-. 0-L5,X0@ R0D00S 80 00p ,@0.(".4". -L MK,K 0K ិ K 0-L0M$ K< <K80 40 00 ,0 (0 kP$ K -pLQMU`f "OOK5 `pU?K`!PS?K 410CS P0SK d5UK"R0LeD\U?K " 0SK 0S z,0S JP KK 40S@ JK$@⨬@4`V08U?K 4 0 dP`d`KK0dD$凬@4@p 4Wp-pGP 'pGWd$0 #pGKK dp#j@U?K P࠳ࠣ\^\ K?K#dPO?K` `Vp@04PZ V0`p= g 43w 0 VW?K2QK R0 0#P Q?K`W?K wQ?K0Q/K`P  S  RK/K\"QK1`" 01``pV0d8`Vp`p`pdP#/ ` 0p&%@1+ / 0 QK``p&5;G%0 !ԫh1@`V001QK K?KP R0d WK 0PU?K V0f,!j\SK?\0{L1!00KK⥫0 0KK0s _n}Zds"Ce 0ំ-.p ..(- K.<.Y@e*.lv.A/ .4"..?~| D!@"% +LŠD! @ 0>Q/K0CS?K R0x G @ZK?Kd ?@0 0KKp (K0 VnQ?K`piW?K  0{W?K P 1`PaK0P EPd3)0S $K0P.K01K00KP50`u1 APpxP5 PVH5po P41P> 45P*P7 .0P1   P 10C 1 }9P10S  .PP  0P1 PE xh9`P10S p1 P P0 P PPW @P t   %PP %P 3sKd0p P 1? <<|3d_Zp P 0SH83sKd0p P1? y< p P 10S120S 2d+&0 P Pd00CS0]pp P|2|bf R`2d 0TR L0 dL\  ! 1 ;Kp1@S PD d00CS0p0 dL\!  1 p1! P5,. ^0(U^0C 00E;```^    NR%    #t PX Q0<0\n<-@--l-,*\ ".4".o-|&<-<- 00- L@0SP 0 000@ 8P t0 0pP P0 0PP ,0 00P  0 0|&P-y `,0@-@CT @ T00 P0S@թ0 1 0-S0QL`0P2V h P ڀ100.S @pd1l `L7X1P@  H,7P10T0!0!00 (1( V 0 ! 0Aq000 000000P 0p0S000`0T h0h0 @V t0P$0`d-,-j1T&.P&.4".6S ".G`*.-J-*. P-- GXc 00-LP@ 0 00x 0t 0p Q0 `0 0X @0P 0L PP N80@0S, 00*..-`*...!.,".- ".-  P0-L k<00S 00 0(p M.(".4". . -Ll&@`N0S P0S p x00PPnT00000S \P0S p Y0000 0m0&`.*..*. -BMLM2P 2p0SB 20S R$5 P1  R 4S4 Y$ (K4St2BK+ @,0K4P/S BK+ @BK+ @BK @~PBK AՎ``!0< 04 0f00@$ 44 |1D4 8 X \1oXL1LBK A0. 0Y100CcS``V10X 0o9<40$BK @44$ D48$ @ 囧BK @߱4SU009$4XPo P0 0u4-h--..D,-t .. ".!L&.P&. -L M1A pR0 Q`00S Q0_cP P (K'(0 R 0000@ ` KPl00}S0s00X 0S$P,0c -,-P-4".-P&.|&L&. -L @ Q0*0@0S0 0 0S00CG RK mU.RH T:* @0GSp0d000C R9 T+* @0GS%@P.@ @@.!.0-\Ql--/ -p`L P@bTP0  T  `00T  0@ R   `FVx`00CS0 C PpTL000`000 0 ST00:Hx&Z -@LM`pP0尀U$_  00P$0K*aP#lP`0( \kL00D P 0 $Kp-4".qx&.h*. -MLM`8 @ 0~KpG.K0@p3 B  7P Kx#x@ h`30S, P Q PUP Ϭp@ 0`00C.K00 B26P CK"@ CK`A刉(K ᆫp.K0 B||x@ wp@ KLAj>K 0C8 0(th 0B$2 8 R 噬88 @_ 0 Wp@UQ 0$SBK II 8SG 0AS K A80S  mI8, RdPZ=  R ( m( /8C0C8 p8, 0S 0 0x8 8 PC>KP 0C.p |8S  |8 0 p@@b.K0 BL0[P<00+*.}1p . 0-@PLK0h깪 0-L@P0 # -LPJ 0-L@p0 s P-L4P 0-LlMPQ@0K|0 0 0  T  40S P 000  P '00  |0K KK"PsJ 3 @0#S` 7 |J@$0KT@#P tKdP/X3x T< 03 P 00 PU  P 00 |PU  |P غ KtKr P 20S @@@`  H   P ` P@l0S y@P@KB  P@ TO|0S \@P@K%| s |0SP2]H|@Pb pU 11@T  `0p ]0PUږt!P*000gS0 0 0@B@T|Q PUP., -L&.4".x&-#L- "..-- p-h*..0-!. 0-LM P  1 K0Q0S 1 1:Pʔ!KK!0 CRx @R hS \1P 0S D3<S0R01P 0S 10S 0 0@ @0 @0@0 @0 @0 @ 0 00S 0JL&..l-4".b-0-".=\*.,-Z= *.---@-h-.H-".?l*..- -L4M0@0S@K, @Kl@0K P@0S01@K5@00@@K-4- -L-*.<0!R/P(0<18C8S/10/*.L& -LBM30$1 0 1 30S3@TKC  tP   PID#1S<!0R< 03/@ 3 cpPQP RP@BUQ $10@SR&R2@PR喞$$10S $10,S$10S$1 $!   103/P 10 1 $10S 1Sr !2R$10$1 $a $1r P$1 0 Sz0$1 $1GK $! PBa$1V P$10 SP^0$1 $$10S $10,S $10 S$1`0S$1 $!   1 03/P o5$10$1 F0  - 10 1 TpGoK OPU01 03/87.D7.6.D *.pL&D6.`&6.7.NS=7Bj6.0 7. -L  0 I 46. -L~ 05.+.`@-`0 @CT`@ pT00 P0S@XŞX0X x& -LM,PK@e` e l18C8S p||0080  800S   ოpW  C (K6.L&46.,. -L MmH{ x  Gp@' P KP YHg d K_ \ X0/LA/P 00Y,YL&(&o". p-L M0@ 勦1`8C8S P0S M { Hw@0 KΩ0[nS Kp86.L&5.H7.9 -LTMP dKT P H00S@0\A Kd@KMPGK6.L&Q @@0-LWT ͜G 5.ej H0-|ALT 0S  0 L&6. 0-LM<0/LAPZ/0P00 UK0L& @-@0S S S 0\ \ \R \ @0 R0 R -LMP@ ?b0  堀?], ` ?Xp( @V@T*h KiNG1$ K QTVW@ Qs00 <ꀕ&s< -LAMMB^KPE`0 4$ (T ^B  t2t p2 僥d2 `吥 0 E)4K 0E84  8儥("*4[ R  0 S" P㋃@`pᰁ少0SBK Ab1*$[0S000 *4KRP'(DBKA@T  0;T TFP1<18C8S ] P0,T(!v1 " 0M$K4P*4[S S ($ S( 0 0<18C8S @坛| (4BK✐A0CY 0Y DF 0 B>K0C(4 6.5.R 86.H7.7.H6.6.+.I L& 7.5.| 0-LM,EK)P GKҥPG@PaFK0 ,EKPP  ֤ ] x0EK<  U KTP垥ФEK 3FSI L& -LM3@P `psp僤l) `#8 P3 L凤T@D,㝂K$C00CS03 p00R0S0 gP18C8S5 P1 P8C8S 000 0[5'3P|2p2l18C8S  0KI9 0 P^S,18C8S  00 S 18C8S <18C8S 娚l18C8S 0㘑01<0 x1 0K RL<0P+  Z 4118C8S V`F(`p8  <18C8S0 ң (KS 0R   RTQP1K8VC8S 0LLDCE86.7.R xI 6.H7.7.L&6.|46.H6.5. 7. p-LCMf,GK`@P5T1 L刣/ , 0!$1 勣`P  E@P1<18C8S 㘁 P00 a   Kp ခ@PKCVPp0BGK(GK8ԙ86.R 6.H7.7.L&E5. 7.6.3 p-LCM,GKlv@P5`1 XKp @PKVP|@ԣѣzwGKGK8cၗ86.R 6.H7.7.L&E5. 7.6.3 0-L0MPl@@K `@0PP <<@0 @0 00<<0@ K K06.S 7. 0-L0MP@@@K 480P88@ K80 K06.S -LAM,EK@PK4AEK 0 001 d1 010 000 0018C8S 1 0118C8S1 011t 8C801 012 02 28C8SKOL&86.@/SI5. 0-0@L (廣  K0h賣6.{t zt 0-@LTTK0hF 0-@PLP0P 0 0-AMLM$ $P$K0A>K0CCݢPAK$4!@ עPPt1LAl1T@@A>KP0C4! Quߡݡ١+巡@ҡBKU $[ 0R0R0S $  TT$$  T$$l坘t  10D0 S BoQ 0CVN% aL&L,.(&i% x+. -LAM1P P lhl lkh@PHXK,EKDP 廢,0< EKd7.5.L& 0-LMP P @'0@S|BK0P55*\ \-PPL嫗AK5< @EAK, @gd7.+. 0-LP ppGPP0\\PDLK0h耗@@ LOl18C8S0 0K0h辄\6.L&6. p-MLMP P @0@SUBKp5P5t`PP`HX AKl!5(B(R@ @  @ܖA.K B, d7.+.L&08U -PL$Mp8 \GPd~@$4ܤPP0 4P @ <0 4$8ӊp0G$T pW W4 Q804 x P40h$h40d4ppXL@4 0$$$~$Pj p g ώT Tx3 X!  ! R^S ؔeS %FSJ 0S9SES7 0SaSR cSU PSX3@@BP ,=Pq  8@P~ !nSp hS[ lS@ fS qpS. ZsSJ tS0t"0x"x"0a2 P000 Up2 p PE  \ PA PB 82@ 00;2 1 040 4<00S1/ iP<0& P"A!1G01 1 T T@ 00C5%0P 0@ 0   R C "0 l & _L&(&0]E_ 5.H^  -L1. -LDM|P L PaPH @ 0P!0L10SL,10SE AP  1H0S0@PH}0 000SP0 00@Kl0l@0@ KS80980  HggH0Kj 1.@7. 1.6.6.< t -LMU@pW3P=@P6 P 0/S2 b h(K]PXe0S, H5  @5@<5 45 05 R- +5 400000@T ,2P 4 @$K4 $ 0/S@P x x xxpp'dl'!0Sۜ`(Qd0S 叝p=0c  (凝p;0c0S00: (.匃 R  0S l3Q 30S 6|`@H: l(\33 R 2Qp 0S +orp2: (@P 2 (: P 2l!(: P 2 (: ڙP 2 (: ҙP t2!(: ʙP T2h,!(: ™P 42Lk6.:u5.0&X6.;&T7.|6.6.O`7.T6.R6.+P6.X -LP$@   㬑(&a $ -0LS ㋞~6.t X-0L0CS0p0 00S00x&H6. @-Lh0@S>z6.K2.  7. 6. 0-LM(  0@0 1 E A$ -<P 0( @P00CS0p 0 $$!l00S 0 0 P 0S*000 0@oK06.s <2.x&Aq 0S/S/p@-^?P\`0L R DQ x p lR `0QR@  0R 0 P3.PP 80 Å"Å^ P"? @"/2.4. -|L⚒t@tPt` 0TS 0T \00Slሒ T 0T* 0 ~ @&L&5. 0-L0MP@@K@K@K80<,8 R <80  28C8S80@ 880 <00<0 40=040 02K18C8Sr.<@ @ K@0 K06.6.L& p00-0LSX@\P00S0G00020K0hyH6.2.t% 0-LM0Pl00K0@ 0S 0[S p0 K S0 [@803/K0R PL&&5.6.< -8AL1`S 0S 1PP Ap P0 PPe  P ^ P  W P R P   tt$l XX@00#0 00Q L&2. H6._?(&4. & 40-1L8C8S 0P 㖏L&5. 400-0@L К 0K0hۚH7.7.5. p-LCM@GKGoK A͚P1[ S0@018C8S U01y0 ؑ0Pn01K0GK A囚Kp K BRGK0 A塚00P yy01K015.L&5.H7. 0?o2 0/L& -AML M@4,2@K $R$$ $  r (4 iPڶ0 (4a [P 0SS WS BSc0 AK+AGP  BfV0S 010SA>K0CZAK A18C8S `0S RAKHAK @"   |PZ 0@^S0C\ \00 P0S 0 ꈑz 86.6.L&7.H6.5. 0-PL@LP@0 P P  P @L& 10-LHo -L@PP" p00CS#T Ԁ Ā Ā Ā Ā `V  PP`?P0 P00XKh; 0S P0000 !0S0R 00 L-`0 0CS`0pSXX0X x& -`AL0P0C!S` 0000CS1 | d | | | 0 "S 0S!廏巏0 0P0 P 0 `壏0"S0L0Kh:,嗏0 0P0 4.<>K0@- R RQ \R ^R^@N  @0 N@T 0N@T!0N\!n0( ^00@ 00S@ -L@ P1 lql =`P`gPP1 00PE 0P @ @V P 5@0S@0S:00@ PP?0P PPP P  0!SP4.KL& -LM@P@AK\1  @uAK @fPP `pAK  @W@Pu00u0K 0T P 0T@ 0000S AK AD媎AK  @\!P00AK @R\&L&5. -L`@#PP 0 @A(( P@ -LM@`p@TnKP ˗ Kl R e xa(R( dƗ0 PwP O<rP K(mP f@xt 6.yt 4. p-@LM(  @ ;0, (@,000 06@P ,/Kp0,|0 !K北 (`!@[P@!@K(?0EP 0S  0T @ ( 4.L&6. -L (,4. -L M@ L  {_P @{ 30P3P xǍtō. Kd˘ X $z 徘EK6.xt yt %+.Ef@ 0-L0MP%PK01<18C8S 咍Av@K80@ K980 9z D<E4C0 ۖ,0E R Ж ̖.P *1PP z0(0S"=RP00ES $    pDdB`\XT H5FL&6.&K4.- d 0- L Kh*6.K --LM _v0 R   K8. --LM Nv --LM 0 R   K8. -ARp`P@1LT <pP+`@D -LdM @ Pጤ0Pl0 ㅤ0P0 0 \K 8pT0 l0 X0 0`@ dP `P@'Ktp hp pp `0SY W( Vp% d0 n0 d (cp  u T9 @p@oop`0b0`0 'K ?'K`0ST`V rTꨏ \ ( H X Б d Q 'KR00S劦l刦0S'K  (KD 3  d 0C`0 EI0t @p0 d QQ * 0Cd `0 @xd Ql 0Cd `0 @md 0CPh d `0 @dU@a d PE h  d 0CP@d `0 Sd 0C@Td `0 KU@Gh  @C d Q @0Cd `0 ;h  @7 d Q @h0 @PP-U @)80<"dK-P@ (dK-0S4 p x T T0S00&S `dK4XT08s  lt0 H0t  l0P Ttp00p0 ZdK4@l0X0 8T0 SV d tP0CS`0 00 Sd @Sd pPt0C Z`0 d XV   + F c 8.}        ! B Z j    -LtMp l t `h oV@@T 8PdK  Y  |> 0X0 h2hT0 d2 0 P@0 `E P <@P Hp@ PT0S(lP h!t0(KX` T `0S(hpF0P|  hx0 Gpx0h @_d `0  !@P,dK@PXp J lp  ZPp0 SX` T dKDP$<0$800$4000 0'<0'800'400\ 0  lP$ t&  t% %    -LMP1@ R` xX5000 00p`QP ,K QP -`p 0`< 008 ?@PPd@VX0&0 0QP(` *ɐhpf`R0 }>5?@l ,Kⲉ$ K0@0 S$K @. @ C<, K₊0$K0t& @ Z i p &I p-LMKP!0: S0D 0 SPK@` 000pKp Jp P @TP0dsHS 8$  K  굄8.v ~  0 R R /00@-\0R@ SaPNU APNU @S AL^ T00  `0`P@P-L@@ d0S 000S  8Fᒇ4v.8.v. -LQP8뇳 0-L@Tw0 000/8. p-LM@P 0S`P,KK0CPCP P4L Pt4P(4x0S 40S||4S4|dSdP 0S0`00 S P 0S0 `0tP 0S00P34HP<3 R  d s  0 P``4 0400P4 0400P4( 040$0PkPPe 24x_Ppa0pS (ht Ot(h( " BP\a0S 1 (h BU 0t(hf( q z"P`Pppp0PSt _40S ,1 $K0|44, P 0S & Ab8.]=v.`v.`=|v.\v.c=gd9hv.Tlv.Tv.8v.Lv.dv.pv.xv.Pv.w.d9.0)Tv.8.f=*x+}XC`p/ 0@P0&iv0 T (K0  R ЁYX40 H0 _40 30@P=.=&`00S T R $ <0/=C///=.v.X  -LMЄPU(K00Q`C !SR04 S05:?0 02@0 Zo@U !SR' 04 R $ $ R R0 t0P 4 0 40@!0P000 00 @0 0 0Pa @@,$(4vyf0 KqlK000V 00`S KB> CSRD 4? ` 00 QP22s!SR'0$0PR*0 R    @ @   @@04 S@05I:@_0 KB>C1 qO   0! R!S / R  0 P0T! B΂L`S`L K<1-0BS> U6,K!291PUP00)K⥍P)0+KSR0,KSR  0 0 4 00*b0p0 P \)2x 0L00Sc =.v.& >(v.&v.<v.8.v.v.v.\  >dw.<00@-0S ($,ē04VFY00=. -X@L0Sp 000$R C.@B`p`B 0$=. -@L0S𫝸|0Q ܋0 0\0 p` -؀BYX 0 2(Pp 0 ꈚ&=.8.+>dw. -(L@XP10T0000P 00S4 $B>`CWV ?0"0ˆ ^0T0t` !QP }p 00B> CR0C>C0 P@0D=.dw. 0-LP0P0 0R AT 0 RAC@A000=. 00-@LT04 MD0 QP4@ K0hu0)p0=.dw.0@-0S 0$R BCNP $`Pp ? ƒ "\AUT`N 0$@=.P00  ?P/  /᠚& 0-LM0@PT 40 0M DK00T@ 0MDB @C @004=@C @P@C404@@ 00 QP K0h0=.=> 0-LM 00 K00-B>CB/=. -PL`pw@P!ٙ 0 AC A0 400 At P 404R0$rd$Kkq8.=. -`LPU4 @ P@ Dt4 HT 04 0  00@Kh=.8. 0P/=. -PPL`@ 00S E0S *Sn0S 0Sn0*S x0kR  dR   0C^S0SP@sR  uR  @@=.&- B 00^2:!P* C\ 0-L @0@ R S0(9R0R*.R p/bR cR S :@0 B,, LR=.>.M>]> -@PL`' PPpQ PP@PlpQVTx/YP P0S謚&&u> t0-LrdPP0P 0S ~40!0%,(!(K0h3d@PPPPPPP0 0 @ TPP |PlP LmP >>>>>.>>>.>>>|&=.>>>>>0/=. 0S-x LQX  SLLAmDS@#0$  ! ~=.>?>.? 0S 0S 0S 0S P////// 0- L0S@ P0PR00`30R 0 CP00 R R - L@P  D #-?0? & )? ' ? ? , $? ?  &?* / ?! ?  ? &?* .=.?0X;P: J/ᠺ&H&00PbAA0CPQ//D -L MR( P`@&pT KzpVP 0T0 0VPP (KP TP00T0 0?. -LM@`p( Pp0 E K?. 0-h@LMP(8R 808K0 KK00 CS 8 0C8ډ?.G.P P / &+ G. p-L MR @P 0S P@KptP KphT: `P 0S  Py(0( 00@|uC\Q(Ce -L@pP Pd 0R Q @<` R@}@L.P 0 CC p-L M@P` ^0 00 BKp p-L M@`Pv8 R8S#Kp K$K$0 80p S$08t+8 08 K$K$0 0S$08e+8 R?.tv. p-LM@8S00 Kp00S( K,K0K,0S, 80(SP 8`0$0 0$ 0C?URX B (00, 880C8(0 CS( ږ K$K 0P?.tv. p-LMP@` 80(0 (0 00C?UR(00C 8HgKp K(KK 0P$K K 0 D$0S 0(0 (0 R?.tv. 0-LM@8 R KK0 +0(P 00R0 8808*80S K00CR80S KK0Sʯ*08?.tv. 0-p@LXU0C8 EPUP 80 08S0S 0?.ȯ& - 0L80S ?. 0-H@L0S P X@ 8P 0 00?.ȯ& -@L`Pp0 RȔ 0-S\0\: $0 _00?.ȯ& -LM@u`Kp@& P@T   A@P K $0 ( (( ( 80 /?.ȯ& 0(( ( 0 /?.ȯ& -LMPAĀ@p0S$K$KP  `(0S 0S 808808)P IP:P(8 (0=.?. p-P@L M`K@&P@ 00SKp vP?.0P$/?. -0LSP`@P PP 6@>0 00P@@00 0-$@L$P0 $8 0?. -LM@7@G0`S(hP`. Q008(h 8" 0S0S : p(K0S08 Q00((hʤFP %p0 8 0 h 8xW080F?oP20S| $Q (6Q{ PP P0} P P 048bP[ P48XP ]P P48 8tP P0 $48XP 4P48US.8P 90884 (80 08S$8Q UD 048 D(<8R DP 4@Pe 048P: eP_ 48PpY<(KoO488080 SJ488SB0S S 8S<0S S9 ;904880S/ 48,4848 0p48!488S0S S8S0S S8S 0S S 484880 S80 S80082堢 R( B 0 ` U`XF   00 P 00`! 0:gH80S IG80B Q( !؁ < 8 0  B@ SY0 R  S 0 4D0 P@ D0 Z ( 8QS``V @K 0CwK  @)P >K 0C@`p귺CC&C̯& 0-LM ,0Q0S/ PP, x@HT% Kp  P 0: Sp ρX XoxP Hkx@< ,dx06K0ȯ&CjCЯ&C& 0-@L0 700000  0  |0  l0 \0  L0 @8800K0hXG.CCCCCDD+T  -P@0L@`@p|0@/00js 0S nW DjV V Kh_XG.= \Q DD -`@P(0LAJKhXG. -Lp| @P0k  ' P0;0 $Kkx ) ` y/0pP     P $&V $Kk$  XG. D -LY,P Kh% -La@0PSP  SE SKh S S %SS #S, $S0 )/S 7S!Kh.0P S+S@ AP 0S0p0 #00 0Kh400S Kh00!S P  \00S LPHKhu00PU$NKh)&XG.8.(v.D%D -L'P P@x0QP  KhP0Q@ @0Qp`P@ p`v.v.v.v. -LP e>rUp`  0匀 @0SU V0 0040S U82 v.dw.v.00SS/XG. -0LM K0!% KD&+D -@L(0S 0(06PKh2$'P 0S S S ,P P`,P6?o2(0gXG. 0-@Lx0@, , ( 0XG. 0-LP @@T08T -0L,M؎ePN~0>00?00%0 !0 S 7/>0 S "a,0S6N&"P  P >P>0S P l>nP ܭ Rc 80 SP "  l$]P 8 S0SeUU`ZeU@0S& SS SP S V VyBA),P  F$Z 0S:#\ :$+/S 7S0 S0SH`KG0KHK Pr [Po 0,K0!hPDP HU 0EcS X P \ D t d l @ 8 p D 4 D d l l  x  P < P 00F.V SYdPT n0SP0@ _V0 0Sh V V00K Z" :0V :0V :0V p`!V V@0#0+V -VR00R0P @ 0 a0CS004K@K0!P 240@0 @0P 0Sa0@S @P@00Z,K!# 00@0S" aFQ0(| s$90V 90V 90V 0S!P,K!HP 0 /6PV" V V/ V07S <!V V: 0#0*V @V70S 07S ;\50S P!R ,50Sq !R   w(u}!R0 0!ı 6s!R00 !ı0<0!eR00d !ġ0<0<^P0[W!R0 0!ı3 yKaH&,K!"A>30SD0S7NK @ 4 P+ 00!R0 0!ıH0430<0!R0 0!ıh P0000!R0 0!ıVPP000<5(P2p P@ 120S HD"D {|20SPP2 'P 20S "8"0 0O1$8.Pl!R0 0!ı2P P P  !RT!010,K0!@O.P0J!R0 0!ıP !R 000,K0!6!R0 0!ıy.P+ Pl.0 QPf L0 kbdw.XG.v.@v.4v.v.v.;DHG.YDqD8.k(w.w.v.< <DP D\QDG.Dv.D3DD EE-E9EIE8.D[EVE(v.bEXv.Hv.Dv.L jEv.4w.tv.v.~ w.!R0 0!ıE.P|!R0 0!ıP (0P PXP  000 0,000  $10S  !  0 `*{`1`0S p10S |10S P P 0 c1`0S 10S 10S P P K20S (%F42`V @2`V L2`V P P`.`0Px"$` %30 .P02 R2 բ/ ?!!\0 ı0L 3 pP03 R$3 բ/ ?!8#0000S 0 hyxx30S080J?00S/=. 0-L@0 S0!0 -LMSP@`PPp0` 4@ 0X:W  0#1  W RpG Y@G @(K40 0K80 r0 40S  P R 4 BQ4  R Q R 4 Wp10 R0  0  0 < AP< 4KZ80H C0 P 0 R:p@-PP HPV@^^)0S gSd0p00dS fST ^g\ 0\^  \A0 000   / -L Mp 0 P@䠟&. QP~0`PP40 ` D40S ``F0Q@0QU*0@S0S000S 00p0(KPuE Q-LP KheG.wE Q-LP KhTG.E 0 EG. 0 ?G. 0-LMd@P K4PP  0S K $P K0G. -LMP2@T @(K]PyÉXP0`py@ZPP 0@0 QP᥉ xxW V ᗉ0S0 MR +R GR  SR 0SSZ SER SnR0SdS0Y CP,`KP&P00 0 0eS cSp0800 vS xS p0:pP  0 P0  0 (v.G.E 0-PLM@P 9P P@ QPK@!$r!K0UvE 0-P@Lqq 0 $$ K0h &F(F5FDFJF -LMP1p0@-[d`4P-@0Sv.(v.D\QGF -L M0p0`S-R ϙPP% Pڔ Ki@@@@0 ph@ᙂT  Ki襙 K(v.GG 0-LMKP(sP@@JIDOoB}K0 0-LM 0P @RP ^@VVKrPQ@VK0@T@0: S =*@U w.&& -LMK@sPKK0 00b/ 0-L@P0 P0@/R000Sv. l0-0LS p`QP fQP@P UTv. -LPP 0SR0 R/ v. -L M`p@P V 20St20S S R L200CS@0S (200CS ʈQP P*? QP D`V5 1`r`P0Y00 SJZ.Z@PVl10S`10S 0 UT 410S010S$10S1 1 000S0 QP@PX PPl0AP QP Y  00 (Ko `V 1@v.v.v.Բ&8.`h.h.v.v.GH00S <0P/000S $0@///G.v.v.@v.' -L`p@P@T 0@T@@PUJ0ZspU ,Ko5 rT j PT 00S@v.v. -LMPP P @SP! 0 SRU00S$Kk"KAjP"K $KqP 0@`p 0 @{QP 0 v.@v. -L Mp`0 QP@PV KiM0 @ 0S K0PP/ز&0PP/ز& -L P Kh 0-@PL0 t0S0 T  00S < 00C0$K0h   B 08.ز&G.0/G. -pP`L@T0Y@a0 "000 0|0UP0(0@0@000 SP @   0S 000ز&G.P// / /00//0// / / -LM@P\0 UT@P(K,30Sx 3 3 0S000 0,P`p0p PaX0W`p@ P P0t T]0 00@SPt" Rp "Xl0@P_P10S 0 P00P *V10S Y P PP p ^(Kol?P@10S`Vp0mo 0 !0P00 00Xß0S:00 <00 TH P0 0Pڜ X R0FH Pp0@P\000 (00@P_5@q0 ,dw.w.G.v.w.v.v.v.v. -L,M`pRV0 0#KK(K20S2V 0V 0 00PD20S V0$K:P20S @ T T P P; p 0 P6 0#KKPK#K#Kᄑ儡K#K$Kp @@$K 0 P$KP(0S%0S"C@@T*$K R?#K0 pK P0KP 0S0S 0 @e$KR0KcKP[@00S^ 00K$KPV *4Sdw.w.G.v.v.w.v.v.0 QP-L@P PVp 0 P P @0@`@K@PP60@@Pꘚ&H& -LM@PP! @Z =0000 0 0 000000 j(20S3 (KoOP (Ko`p r  T0 RK `p400  X, 0J | x0 0@(KP 00C S3ʮ 810SD`1`0 0`0@d#KR0Q 0 000 @0@#K~QP@P 0 QP@P P0000 0 0t\w. Hv.v.@v.v. -LM`p0 QP@P P x00S `0 (KV0 @PH(0 SK`a w.v.-HNH -LMKK  K -LP |Kh3 `p0 P@QP  BKh@3QPKhlH@v. -L@P`VP P p@P400S  Khw. -L`pt0 QPl.j0 QP@P@Kh0 P0T0 KhHHv. -L?08000  0$  0  0dv.8v.xv.Tv. -L&08000  0$  0  0pv.Lv.Pv.lv. -L MPpz`z?oV2@@T P -|V )| 0 00 00| |@p(KG. (1P-0L@`P S P@@SP&VP  PP @@R 00SP0 0Sh@P R w@@sP00SP =.G. 0-Lt@P 0S\00XP 0S<00  ;00HG.FCHHP/ 804   $ ( , 0  R 4 /G.v. -LMQ`0pSp1pA0S 0  P1 V    (1 V0@00 000 00S< K8<KAPP!P3 <0K I0 0  CR00040  4  0 B4P `p`p0UQ 0 Kv.v.G.&&+ P-L0G. P0-L@ P000G. -LM@Cp4`0 0C BS0S0P<0 8p <0 W U0 `0C00pp(K20S 0S0 `   R0  Q 40 H000 P`0 400P, 020Sq 0000 0 Rwk4 7<0PC%48P 4P Y p 8  `PFt10S 8P040 V 0Q S ҷ 00 |P  vP  00S   eP 00S <0 CR40p80 oᨂ0\`I PE 0G. w.=.0#G. -BLM0`$000K 00PP U , R   `@Pb0S0 000  00R* V0SP P0S0S-  00 00 C p0S X)0K  `0 0CR$ 0 0 LPY `0Qp `pP5PpP`)0`0PP&&NP P wpPp PP0 000   00 SP0C 0(KG.v. w.tv. -L M`pPWt0t@ @@ H@L00PPE K` 5PPG.&tv. -`p@DPL8@0S 0P @@@G. -PLM`pSd4@T X 04P S \  R0   0@@7T`T @- ,`K00& hp 4 R0R000S0 000 0C 0Q 0 0P0C0p0 0(KS @Tq 30000c 0 0 0 X@>_X@]@$0S@@@2 RXP:0S t20S DP W@DR@@  y@ 20PH^P ` fP T_X@@ X10SmS$Si10S SU0SR `W_P@@ P $@ 0k@P @ 40 BS@RPB#yPE  H00Pᜀ @S0CR0S*QHPPE`  PPEU  0` 8w.G.=. w.&tv.&~ H. -0BP0LP`p %> CP0 0 U1X(0QS 0`E0000P@0(ꘑQ 0 (Q30@08P 0L 0R <10?P 0@X 0S @00S0S (0(`Q0S@0 Q0@ 8Pʈ1PlP ET EU0(06@,000@00P(0 G.8w.J.=.v.tv.H. 0-,@L(0S%>0(000G. -AL0P 0P0X0S %> CKXlB YU"D!,u>P H.& &7LBLML<} -PLM P P R0 0 K0S Q\S0H < 040 K000K000K00K0K0!&&]LLP /P/ 0 /L v.0P 00/(w.@v. -LMP@Up`K !@KPtpQ \0A?o 2R0S 0S@V iP 00$Q00L@w. -LM0 S 0*( (T K * TLdh.L 0-L@ =0h.LP/0S/P 0  //+ 04/dh. -LM04 K! v Kdh.L -LMP@`'0-S0 00C  S0p ` T00V K`!HSp  0p@0A ^T00RpgKL -PL$MH  c4P 00S S03/040(Kg40 HK@P<<@ H0 R @H@ +P9  P $P P @0@80 ZF]apDWpp@T]804 S4KQ9P 0P,*-P-P 0H0 @0 nP0Sz@n@+P0H0 PP080/0 <KPH <0+S<unTH0 z@p8 KapGW@KppL0 @ L0H @0 0@ =SP 000C0 ,K\!s H 0<0 00 CR q Tq ,q q ,q ,q ,q q 0U?o 200<S 3/<P_ U W 0R00R0H00S4@<H H0 S 0 <KePH .H00S HKpdh.8.h.FM ML -L@PMp0 `@P U0@ vK!2KU  kK! R RU0  Rp  00 CR |s s s (K @ 0-pLMo $@KoF0d k0D 㘕`PPDW-00EPD> K@ -LM0P@P K%P pS@0p0nS sS dS<K<K<K@`D@P 8< K -L)  R(00320 P00S Kh -0L000`@pTP 0@T 00S>i0@0`S p00S Kh\6'T0@00@800S ,0 KhHw.8.v.v.lv.к&Tv.tv.v. 0-@PLV2f  0 0&Lw. 0- LRP`@ t00S 8J 0PS @00S f 00S 0 8.v.tv.v. -LM0p0`S@  d000 @jPWl0 /o"x`PP i@GPT i$KP v.8.5Y 0-@LP 000o/ -LM` @pP  0S ^S P P W@U   $K @ 0 00040KhQP4000,0@@p p p@0@(0@ 00/0@@v.m.800@-00 0^ʎ1C0@ @@v.m.4040@-0 C1R0AC B@c@v.m.0@- @P 0000CQ0@ @v.m.P00@- @P0800\0@PC00m.@v.<0@-01P`@PUTm. 0A@v.L0@-D0@ P0 BQ@`WV0 0`@v.m. 0p-LM $0 0P@"K 0R`V ,Kh>0P0@"KSR$ @Kp 0"K@v.m. 0P0PSC@/@v. 0:Q Q .Q ?Q0 \QS/0S// -LpD 0P`;Q@10C"@C  ;0000m.+ -LM$ Kz$K K -LMKqK K 0-L@PP0Ts 00CSK0hH@0 QP0@v. 0-0LdS@ PS bS 0PjS BS bS0 00P lS pSmS tS00000 0`v. p0-LdPd0d@;0PN},PVyv08;Xw.h.:& -L4M☆0PS@P `pt0S P Y PP @ *D(K:S9  %S .S D0K0C0KDK4 ?S \S0DKD0K0T C0K(T @@0S ,K!T0 gT0@dSH PSd DSF LSD BS0bS- 1aS# @mS= fS, ):lSpS= nS P4 sS xS P4: PP 4rx4t0S OQP P PSQP <P00 4P00}0Sy ,K!T0 T0@B0CH6Sl ` ܎ $ ď 4   ̎  \ p  č H Q0R 0 +QP D Kl2n M0P0P2 RP B?RQP 0G0EP90P01 111 P  l10  0SR0P0PP T X wX T0000P 00S 0TX 00K _ 0SR0P KQtSA Pj ePHH(0P,om.v.m.0v.8.v.\Q@v.,v.B0C& l00-@d0L0SOoBoH0H0@0<00A400AA( 0 0w.h.Xw.&tv.lv.Tv.0v.(0$00A00A0Atv.lv.Tv.&0@-@\^ T0 0^ !R 0\  A T 0!@!T00@e p-L M@QP`@ P&P e0T0 )9`PK@%@ 0T X0XR   QKp -(fP  u.v. 0- Lo -L$MK RQ+ P@p@ ` K0@D10`FA V 0S7W P 0 000 0000 0GP(K Fo^Q K  8 3 V8  K P&u. 0     /u. -0L0`S 3@V PU0 000S`|$ P0 QPp x P`  BR;v.u.K 0CBK  @hP )~0S0000(K,4[!S BK A 9P,0K04S S S 4 0S 4$0 QP44 48 4 0S B>K 0CC.K8C0\  ? 44 4$  ^Q044 444RP S$R 0C44 44  0F0P0000\P044 44044 8&u. -`Q`P`LCMVPp (KCEU`3#S csP 0S PEU Ь ج TSEPg`d a ``๻0 `-Y ^_uPX_U"0S000RRRKK9P ,0K@1P S@  > Pp K?KQ 2U >vP 0000@ 0Q @ 0P @ Q @000 0Q @ 0Q @Q @ ,1[ S 0S 0S P  ?Th0 0 000 KK P Xl (0U uu.8&Yx&dw.|&YYU 00-@LP0P P pP `P MPM000008&YYYY\Q 0-L@P 'P P P,0K0hYYY -LMT!0@ SN A0 #@P(KK 1p0`0:0 Kl#K0@P #K 0#K0 UTg00S K 0.@00D0 D00 :P0S 0 SSV@P@Pu.dw.Zv.0@-P0PPP^0R @T  @u.8&0@-P0PPP^0R @T  L@u.8&0/u.0/u.00S /u. -LLP 0 1hw./ -L MH@ K3p P㸹0[S00KP[Khw. -L^0\^1!0  ^ @Q 1!0 [\A[^^ ^\00]Q00 Q]Q 0 \Q\ 1 !0 ]Q [Q`.FQ 5 `p0]X V0\\`[V0 V0 nV@0 \VR 0 0`0\  ,.(.ZKZZ 0-P@ 0L RR\P L L D&@D@ K0hh @@|&,.(.Z p-L M|0QP`P @1SP L0PD0`0 0$0 R Kpt.(.,.ZT. 0-M0LM00P/S $S- +S00- 0 0 9S%\SK A@P0 0 ȇ0IS8[@S0 K@00K00@00KS0 0A|H,.(.[Z -LM@$$ T(K0rS aS bS @tS {S000`V Fp` 0S0QU02p0W000 wP00  S0 404 `0 (WP[P.lw.,.(."[ -`Le-KeMd? M B0 TTPPoV @?@/0 8400$?$_0 R?/0  pW>.0  W Q >.0  Q񟗼Ƚ ( Ի P 8 h  p d   R @     P R @0e-K` B00`S U =0S @S#SPPz ;SP ne=K0C0@e=K0C0 P00$ AP [P < 0Se @,S_ 0S 00@<P  `<0S  00@AV < ,0 1@` PQ @;Q }Q ;+0 OP} P @\P T;T+0 pQm PUs P@ ; +0 ,\\\ \0\ APP000H Sp `KP >K. P R @LD:0S00,*,Ip 9)0    R @  R @ P R @f0S p @0S@ QUT 1@ P U8(0 \2p0W 0 噻Pp8p(0 .P0p\PC_oSRPU (8((0 x8$?K 8AP7'0 8'*K, B (RpR   K8@5 p0( 0Ye-K B00S t'   e=K0Ce-K7 B0e=K0C0e-K B00P\ Q&e=K 0C0PEe=K0C00C Se=K0C0e-K B00e=K0Ce=K0C.KP6&0 \QA ZAe=K0C0Sm0S 08S .K 6P00e=K 0C0Ee=K0C ZK,PE0p 09S50;S c S GS 0x%p5 0pZZI) e=K$0C  Le=K$0CP  0@^ Q4$0 LLP5 P\Z&Z  PE^ Q4$0 Pe=K0C1 CRZxeK A Ip0"S YD4$0 3iS: IS7 gSZ+ 3#0 L$pS& wSY3,>K) QQ. S /l3l#0   ))0Sf 00@a909T90C9 ))0S 00@  Y2 0S"Gp '  8U@S0  K8@Y8 H20S @;S PB0110p\SSP1!0 TJK,@DD P1!0 ꃞK @P pp1 0S 00@0K,A AYp 㶃1!0 op0eK Xp X 0 0 D]@10SQ000 S9Q|0 P0S= @;S }S 808 0 <)09)$.m.,.(.@[|&H&t[M_[f[[[\n__4. <A\__lw.\\q\\\ly.Y]^]$]]]]@^^^^&_a P0-L@K0hSP0 7Ja 0-L@PwSP00 )Wa -LMT@P`P T K0@p0 @K. p-MLM@ Q !0S000@06 0@0S &V 0 0  0S S @ 0ħt:`P  K*0@V: Pr K0@⮧00Kp8.đ.@.}H. -@L MP0S`pt0 ^0 d ` ;0P S j$ KШđ.haL.T.Z -L MA 0Q0`V  R:&0 0 (K&V% \V@!  0YZ &R\R`  R:0 0` 0   KcKWV `WV 4 `F  R:0 0   P0đ.L.|& -`P p0RL@* W00 , 0P P -?LMO 0 +P(K0x(0t?PU 040\PPd R6 0S00 C0R 0oPePS$  P0S0 0R*S 0 0R0 04\0S$ P 0 R 00R00 0S0 0RR0S0S$  S00@o0=0C>S񟗔t T X  $ 4 ` ( @,08lQ:00  0p `p凲p:0(00$00S;;0S (0S[0$  40STP(0S$PU ` E ᑧP0(0 A E$ 0< 8 0  00$  0  0 0 0 $0xz0 t:R<000s\ 0P0 0S- q0 S0K0`0S,0`V: t$ 00@ 9@S0S NS 0L} KBP<[S 0<00K KeR0P0s0 :0 0K0 ޵00 ̐ Y0`V:1$P M`0 00 00C0 RP R0 R:x`0 `Y 6Rp D勤P 0S:`8I8 7`00 R:`Ԁ00 0 70S `l70S (0S0$ 尤  P>50(00 P(0S0$  厤 (0S `$  HipP0G$0$ 0 x W0$0@60S (0SV0$ d k%0eQ:00 " 0p `j0 ` R  R  Q 0 50C|$000 P 00$00pW W @5pW,u 0F 0 0 00 H-p4W -KQP 0 0 40 QP9 pX`X0 0 ;0P  ßK p``$L0pK$0 0` 000S 0$ 徣 ` P2 000P 00 pd3p0 -K0-K 0X` SR 0 XX0`0 Pd (0S0s "q?p0 {0$  L?$0P0 $D?P 0S 00P(0S0s"H?p $ '?$0P  ?P 8 R0l?HK p``0pK0`(0S$X X!p `RP0 0$ 0Vw*00000S0K!0  K S0 0@H !   R0 zP0( 00 5H(.đ..8.$.P.H.<..&& @.}ht@Zaaa,.aL.Б. <&q.. 0$ ($1 0X`<K p``0pK0X0`L0<0 0R0((Q 0{Q  $.. -@`PLT0wS {S sS 0p >P 0 Hz0P@p }>P P< -LpO`L@oVP izP1 R @ P@@偝PW&$KkNXPP0=S! !S0 <S :S/ 0S0S U00 000 0W 0S p>S @S 00 0  xz0 0 00 00:ឡP 000BS~sX.aa -`0L@0PT P P# 0S (  H T < 00C?o2S `0S000S000U0U@X.0 0-LMP=@P  XyAKA|=p8yAK+A= P=K0<aH0  BR R R5 /x&(&D0 0CS0S 4 0/x& 0-4ALf0 S000S000S000S000S000S000S000S000S000S000S000S000> 0#<000p00007< <0 0B15s?0 0K0h=ꐓ.0-01S \00P\ P0\ S0S Q0S R P0S0S0 00Q R  0.0@-  \Ğ\ @ T\    %R    萓.0 -`AL0 5S <0S (04!0<P a q0U'0 ! R9  (P г0  ,P dz0  4PP ΡKhN00\P ٽP D 㪳04 0夳P$pS0 .(&. 0-@L0`  }0T  -3t唡h l9P`PT 0 ˟P000ST8 @x&(&a`.b p-PL M 兤P^@P0?S0S@P` K,p Kp/P@nP  0S S @ް0Sڰ00w& Ab-bb -LM 2W0Ib(& 0-0L0@0TQ0 T00 20001S R0S|K0hTdl T@0$ XDK0h2T0@  8K0hw2ꐓ.`.bQb(&0bbbbb -LYM c20c(& 0-LM@Pj K 0S 0@T \00K0V0"S p` -L M@l;P Kp =wKc<0A-dps"0QU"RŒU<0x&PEQ @L& p # L @ "L / p # L  "L / p # L  "L / p # L  "L / p # L  "L / p # L  "L / p # L "L / p # L "L /0S00//00// P0P 00-P@!LR@0 U0 ,>U0010<.p.01//00/00/00/00/00/ 0  /.r 0  /.00/L00/`x00/ix00/00/rx00/x 5005/.00/ 5005/. 0  /.L 0  /.`x 0  /.ix/00/00/00/x00/x00/x00/x00/x00/x00/x00/x00/x00/x00/x00/x00/ 00/00/ 00/T 00/00/x(0 0- L|1㺉<.  0-@PL@|!孉)1S 0 h<. 0-L<. -@`(PL0|Aw 剉<. -L⒌ -L⊌胎 -L 0-PLێp@ ^ 0 0-PLʎp@ M0 -L MC K@u%PbK 7 -Lo  e ` -L50. 0-LM 0  K  -L 0.. -L .A $-5L4c . -Ly  -L 0.. -L .% -L. $-5L4c . < -L. < -L. < -Lv. -Ll.  -Lob.  -LcXx.  -LcNF.  -LcD(. -L:. -L0. -L &.  -L 0.. -L. -L. -L.  0a- L. 0-@0L@K0\. 0-@0L@A0\. -LM K♥ Kn5 Ky -LM K⊥ Km5 Ky -LM K{ Kd5 Ky -L0a Kh5y -LM K_ Kf5 Ky 0-@L@/0 0-@L@/0 0-@L@/0 0-@L@/10 0-L@E10 0-L@10 0-L@00 0-L@I0 0-L@ 0 0-L@0 0-L@50 0-0L,!JP<. $0-0L,!@1=P<. 0-0L,!1P<. 0-0L,!%P<. -Ls2 -Lk2 -Lc2 -L[2 -L!y -LL -L,y -LQ  0-L 婊t. -L2 -LQ -LQ -L -L -P@p1S0Ű!21( L "S` &0110 $1Ux  U0a wRb cV80S  3/1S$Kk"L0( S0cp rzP0S  400CPY$` SwѓH1S` !0C B/!?1P0EQP0 E/R 0U0@08!C8xP00S118zP`PxP@a@1S-020( (P"JP P- 3000+PP PL3P ?P 0CP >PP 3P 0PpvP P1Q] P q1Sʰ1 ] P ݍbP ?00`B0R0 v 0SpW 0 03/p P ``y] P 寍 ^~ `1Y~00H10As0M40 R P ?00`40040 14 R40S 03/P4~ PP /~ P(KqP uP APʬ0P0CU \000CPEqP ?z  ~T0!]1X0P 0P N0CPȓ. y(&zAz00zx&|&R 001/ȓ.P0 R0//ȓ. -%@L M$pa00 PU!4 >0P4 @(K40 40P0 P0QP#<=P 00W0000 0 000岁<10, 00080040 0$0 0p(p1  @ȓ.z P0-L0D0 R00A1 0P z}< K0h趢ȓ. -L M⌒p0 #W0  p   博0(KP0 R  R CP  q   1@@@``Q @ R R R P p R p      P R R P p p   T @ FR R@@ 4 4 R*CP p ~ V! B R@2  @DpTܓ.VUUU|& @ -L,M@ oSQ0@ <0 pw;@T`W[ 60Y0 0S @0v 'ǝ@凅8 内0 勅00P@0@40 0pD0 @00H0 2 0DSpDU404pE40\U00ӧ?0pU0 CR pC4 0ER 0800 *_W 20 8E008 2 B偙2n P~ P7 + P[ P" PJ 0JSnt2000 h 0D0 0 EDH0 H0P@D0 (~ ~~@P0D0 AP4 P1P1 0P1 X 0p00@0p00@X E@D˅PE D0ST!D E࿅PE@_t듐HT@D0 Y @ P VP@U@°H0S 00@  B08vo0000<0S U@0 0 <0-(Ko<<0Y S ܓ.D|&{mR(& -t@`PLp `卄PሄP0U J:`PP P <`0000ܓ. -LMP@p 0L-pTp +P@@K0 00ɘ 0 0`` @({+Pu 0@P  &ܓ.{ %P-L@X`0PPs Dp R :P 0S@@A@&ܓ. 0-@L%Z00000ܓ.0 ܓ.00ܓ. --@LM00 U> ~K --L M00 E> n K --LM  b K 0-@LK0h< -L Kh< -pP@`LM0 0 x > 0`0 0K -LM K -LM(< p8 `匃@凃Wp0<00 M=00  !0pS_ 0S\ 00SX塛Ppp00pTpP80s@DO@080 V\<#` ぎPRXJШȀ0 S80J0 0师@PH800 0VW`0<00 =00 000 0gT >YY  t #zzz(KP 00R0S 0S <0PPP#P3P`V`꩎P 0 C뜠_E_{{ Y80 G00F0K@`pr_*_p{{ܓ.{0 -LM,  K p-P@`LM0 0 t = 0`0 0Kp -LM K -pP@`LMv0 0 R< 0`0 0K -LM K --L M00 5<  K 0-@LOPP0ܓ. -Ln 0-LMK@F*@7$qPU KH%  X00h@PU K8%T   xX00000S$$K0.(w ..(& -LCMP@ 0P01 K_K 80-0LS 0P Khi$.. `-L̐P ,)P @()8?o!P Kh(D -@LM 8K<@ 0S0$P)  8Kd{0S {P<K <0Sj 0[ W'Pc8K@@P_8KB(8K@\-&$KP@RrVڔ8P@8Kq?pP&=&&P &d20S 8K?p0$A PHV바 ( V==$P 0)AT 8KP8KP 8K?P ,`8 7PP00a8K)Q !V0p4X`T,`AT48K@p80T4:X$ 8Ko?PQ  R@"4Q 0Q  R@8KN?Pp8W`003/P4,00  h0S  R l 410!8@t.<..< 0-LMM@K+@-K+@6KAK+A@"AK+@+K@a>PP AK@\>PP 0 d @@@@@ @@@@7%PK0AKKA@g=  0-@LM (K⮛1@,@ c#P )@Z  <P A0$*!P R)QX%K000KR00S 3/P 0$003/0(K$((KP(K>?P1(K?P-nP)jPP%(K0?P! 0@K 彜'UC,K ,0S 0] X6&P(K?P$? =R'(K(t.<.^00 -@LM (K*0,@ @V= "P) @ P00*!R00K$Q (K5((K@P ,K ,0S 0^ %P '(K?(Kt.<. -pLM 0 0Z#V*0S p 0B0 0 SS@@@P @ 0 S0 0p0@ᰖ0 S:P @` 0P00 Q %Si0S dSN %S%Q0@ 0S0 aRe cR0 K3/P (KiS sS 200 P 0 倐ಐ@Y, K @`  R R 10 R @ 0QR Ku0T K`\P0S  S 00@@Q|0 @$`R`R`V0R@ KDЀTh ,0K0S  0! S 0@S$SS0`@V:Q 0 A|& 0-LM@KHPU K  告S00K0ll6P \K L y a7( 0$Y . -@QLPBT<0<0`000S  7 0KhQ ..} p-L M8A`PpS0p 'wA{vX{ w6{GQM{vQ뤑+}0 A堂PPxxFQ붖P YvYvv ᾚFKp0<}(&  -LMpPVK" `ᑌ2 0KV?KK:p6 0(KaKVK腟E %0S  %P R 6$ %0S  t%pP `P {p@T PaH$F$ $*$ %$l<$aKVKx1B?a/Kx1 LkDP  R@P  R00%Pp P : P  L: 90S 9P$P 9 b%00ː3 0f{3 zK吘2,K"!0311`01   0K HrKzK?K0/K rK  1 #P,0SVP,0K"!!03 KK# PM  XU $ jK0h2P jKzjK_0S$P0 KV#T2 <"QS x#v#1P È 1 m@Z0[TPU Y5 AP,0K0XCKK#x1K_K,1[SJ_KPE @ aKKK 00R0SQ :{0S+ 02 {P2u崏q00PT =0z6$.&ptbtGf@. .Xjxg.jJ|.% o 0-LM@KPU KU )Q00K0PP K?| d00S 4L 0HYꭗ40 ,5.w.I(& 00-L(M 0000@00 000 0@0@@0 TPP DD@0Q ,K0hUS &(&. -- LM0@ IK1 ^XoKIK#P 00$KIKLQS`P UZIKFI`PZ w0Pp@@@ @U p00XPI귺A --PL8M 8K@ . @4. - MLMHMXVUPoK4- AKP =Q   9-pK,Hf윟0堦S ?V:, K4e0 w=C$ C< Ὅ 'g0 0ᴍ|< +K0 Bl`0QE0C ^G`0 0F0PP`|!tPC=K 0Cx4=K,0CPCpjK +K,`F0C B؁0 ;K0CUP$s0S OBY0X6W5S z!vDqoXXVC0SPK,A0 A]Y4| S< "0 < Q0 ( KV ..(&J|&&.D q.tpD..=.[.^.UB>.x .fxJ ~ T. .!>IX4.]} P 0R// -鿏L!MP@ `#P3S$2K p?K 0pK_:00 0pV@0p00IK0& K0JP 0P/S/00 0 /S 0% K0H08a@?K0p0@ $K7>F -LBMp`xP΍Pl@#d0RX@@ GK@0W<`G?K (({KS..W . 0-L@# K0h. 0-LM K0!P @0@ 518 0/Q00 0{ K.x .e . 00-LMK@! 0 P t t0tP p0E@ 10` /S0000HS104 /S@0@$IK0y ...e .. -L#M#=KM0CCsP#=K0C2@P    K0K 8 {8S@`0` `@P L0 (0< 00 ......n. p-LCMXBX6S AP \60P20S 12"GKGK^1`P 0G?K fc:4S !\Y\PYV g0G?K N:4!SG *00t 0 BCX@XX-1PP) N0H 6<340$-0S !& ! "0S $  -IOPV IKp 0 B|.1 ^..>.X. &).D.\?j`[.m0@-@T^$ 0RC# s@ T\ \@B0 PC_UQ @0#3000@010000@00000@ 00s0S 000\SQ P00Q 0 -LlMP`p 0S K0 KL03/P t0 @ Q (K1/P p0TK℀0K8/P 0 0TK3/* RP0//!01000/ 00#0// -L,MapPA@T , 8 kP800 K ` 4K)40S 0S00S(K -PML M`Ppp" *0JK$@D [ X\5XX SS=S 0 \3R 0 (0  KTT& -LMPP0`0U"Pb'pP b@Đ0 R ) p(K K0L03/P Kt0儡0 t0 K o  |K$0S P |Kw |Kw@4p. -`L@8"0P0S 0 KhdE} -LM0`Q!p0 KL03/P< 0t@T 4/@K0p0 $ K0 0K0S Kw0 KwT `Kw KwK80SC0K, K EKp.I~ <P P00 S ⌊S, R ,0S R : 8 80R:P#3/// -LM`p@,K 屹,P PP ,(P'[P,TP0, xP@$U@@,(T (@K HRe0 @PKZh} 00-SL@P0 0000K0h -L|MPp` ZP'0Px0 )(x((K@ 0S0 !X T 0S0\ KL03/P L0`@ 'Px0t p0  Y@00 0X1 00 0<000@@@@0mDp` x0hKh0 d@ `@ d0S S'P 0d  !`00 0S0 !Z T 0S0\ KL0 3/P L0 p0( @0p0 t0 0t0 @ -LX P x0P 0@?oQ20S QcLPQ@ !P 4000P/$/ //f. f 0-@@Q0DPL@AP0 PP0 & 0-PL@P   v0000 -Lk ,& -Lb 8& -`LzMP@PN/國 փ0  0S1 0S@$KmoKP+ a+P@1 11$11(11,1 1S, `K~P& d0K0`0K# @0@N?@@T0@ꝋ0S 0SAT K]P |DK⠈P `@\` 4 OK00`<1K?}K @a 4 0 ,1 Pn (1[Sk0)#0C?o27 #2RR  0" R6p7 'S$KA0'S $`K`pF'Q``V0$`K0A(\`K C Q 0R$0K 00B,104!,00 001aK 0 0>`p0!& ,104!,00 001`K0 0o>`0l! UJ` ᭊ}K R K⦊01K0aK0K1 0 00 00K Kp ` 0KfP 0[SvoKN/KaK0!.K0A.K{K0,104!, 0 T0K0 0!>0<  td.QNEFX'Q` -@ML`p@@ 0K spK #PP @@ 0K `~sp.&H<@P 7/P &(g~ 0-LM  K0KP[ KĊ 0-LM KK0 P Kp -LaMPb-K4M BQ@0C(mP> 0b-K 0G`P3 BP3 Y KV4@TY K+4@tI K4@I K+4@t`ᴅP@``V8aVY K+4@t+I K4@s<,P )0 Q'4PUNS0$P 00S 3/p0p$QKI K4@~b=K0CImK4`Fb=K0C0 S (K\QQ00H3цP !> ,! L8PP 00S 3/pp003/NoQU $P 00S 3/pp $QU ` 0 `` I-Kx4 B;9/ 0 ``Y-Kx`4 B;6/b=K0C0 #b=K0S R< a K4@b=Ka K 4@_s] K 4@La=K,0C 0Cb-K0] K 4@➝`Pq匁U%IKa K 4A4@'+PG  `P?jY K+4@3sI K 4@+*b=KY K4@PV5P% 0P +P &P !P P Va K\ 4@ra K 4@r`b=K ,BPD0g <.".ku<?j00 -LM@$q@P0 `APKP @> C 01/PP  @T003/003/$Qi -LNM4MJKWN K.p,@D@tOI KQ4@9d7`-_kTP0N-K( B0N-KIK, B(W4J0N=K,0C0S60S2:K,0CtCN?I-K4 B$"@6 0}10  A R "M Ip, $(> ,0483 @ @6$q1W(1)qs(1N-K0 B00, $81> ,04 N$1%Sp4 0!0 NR0,W*,1#MK,A(pA pu; 0M K$1,@0 @0 4;$e;5P p>؀C  p$10$0$10M=K,0C 0C0M=K,0C(0C  090pK,Hp3M=K,0C0Cls;p3SX6P $003/$q|0'V00S `TW0# X##   N3IKL34L0B,NKA0\>P 3X3?D0|3 L30 00  NK00000A0p  (M=K,0C4C TW t3S0Ct3`B "R2@(K0A N? t3RV0`0 V  ӣ? @X2pW0W0S }1S 0}1$1S!> ,! 5$N=K,0C0N-K0, B0N 1N=K(0CPpq00 0 N=K00Cp S$1M=K,0C, CPlPB ;@S> 0$10! A04!8<00S @6a0N-K( B RQ   N-K( B 0!!N-K( B 1b b/{0 ,10141810 @0(1t.0x&<..x..[D J<@&. 0- MLM9 0\%9 0p*@Q`5)QU5 BK0(% @BK  @*P  P` B.K BY*n'0K0$ @K$ A(`P 4.KZ BB(Kp4p p0S`p0  @0 4`000V0SU, RR 000>K 0C0x.K; B89/P< 㑮K0 J  x0.K B;8K 0Cl` ~!VjP00P0M)82YP0 U @&K A['`P 0Gd0S K!@\0S K!@KKA@j`0S K!@KKA@]X0 KS @>K0C  L @L0@Q@1P\Q ` R K@!.KK B@ɱPK@±PK@⻱P}K@ⴱPv``Q`V{ K @u<.LbVD D 6msat.?r%/ -MLMU 0*AT#,DK &&%  5p`W %0 0|Z Q X  < )QU ^K PEPA KK A @~KIpGyK AD.K B 'K A}0P9 * ̙ `9X 9 i ؁P`)9^%I g T Yy Y '-K B ` @X T   O D0S2 E  B  ? 0S # 8 0, K9"0^K PE0EP# ES3R#  " i%|g%xe%0S h`%d^%` )>t(KS  S S^R 3P`dPp00U,4[S2BK+ @4|2) P90Sppp9 0@ , RT0 S00#20 00#R00S P0 0 4nK `F 0  0x; 88/P009 0ST0aaSQ S :S p0ᴑa9 P9P l!`L@!@xl `XA@PD< 4,0 $ (p @9  k R r0 ` vp$А0pĐ0<.IȳN.g_F.%G2_ekt{XRD3 &-9Aa6r -BMLM@pT<`TBK! @BK @/@P`TBK$ @BK @"PBK$ @`wBK @P```PP`(KLLDDDD @0,4 (4@$80DP@<@T@8 3BK  @CBK @P BK  @93BK0 @댣3BK0   @<4 (h#BK @<4 $0(48@Y<3BK  @BK @P BK  @84BK0 @m袟2BK0   @<4 "BK @\<4 $0(48@Y @D2DAR8$  p2p"pp{#P T2 P$PMD2D  - 20)X@p BK0" @BK  @1P&BK! Ak$0 >@0S#"P 0S -p 04(04 0000xB.K; B8:/ P$$P !CKX$pP 0  s `$$0 0`0p84SW#p`8gN"З !Hgȗ m۶Pg9.I<.< ^ȳ 0-LM `2p \ K(,^0@ P40 @@Pxp< ;87/P  c P Rd.d. 0-@00LPBQ PK0h0d. 0-(@L2S0 > 020d. -L M0 0 PP@BN`P@   # PP@G}e#pP@㰠UJ(K;EC  40 GP40 CGP R000 $RR00S@  p@B>EP|&" 0-@LM0$KP Q P 0 kKt -`JMLM pI=K$0CC 2JKP$@DU\bkI K,@Pp`PX N? I=K,0CW  :~P I=K,0C0.,1 0 /P T2X"T PT2X"TN_UT2S0 0T"XpPZ J-K BJ=K01P 0101P00 0A00000P PPvJ=K0CNP0S6 0S&X$KQU!PX 0 RUT2$!QQP0P 0 003/PT2X"S0 S(0S 0SXLd(0S003/PT2X"SP. & 0-SLP@` !a(0SQ 003/@QKh R 0 -L0MP`p@0SK0L K0L03/P $K`p@180/ -LM@`p0P @@p`.Kx B;9/P$K0 @@B.Kx@ B;4/P B>K.K0C BoQ 0@o/b 0 11/d.10/} 0-@8P0 `Lw11110d. -L MP@p`АР0 (R!  !00  P 00)S0 0  )S P0*SR0B `p@P X 00,0` 00000(Kd. X d t 0-P@ML -KM1/KK00 0d0@00 0T0@@@81 0 0K0@0PK]K0 d. -PL4Mp@` 0SpP `Ppp R00V0#S (K0L0\ K3/PP`0\ KL03/P, %K  DQ 0S  $w0 0P  P %K $L04@H0H08p0`S,00T00@0T0<0X080\040`000d0p -L0 `)R  <@Q@*QRpB   !DAHAP-0 \Khv6)Q     TLA^ @@d.Ab p-ML M`>rP   oKpRP@  BKYPPfAK+ @vlPPAK+\ @hPAK+ @hPAK @ PF@kD@- D@0*SP@ )S 0   d.   -`LMM@K c00@K @p W K@A pp! 08: >K 0C C P8:SH PKW#K^P A vP 0 a0CS0S(Kp'KH @ P& U8U2 RPQ RlK✠ a0@L: / K@pp %)=K0C>K 0C0P: s Y )=K0CK A +ep0H: H:SL: $ >K0C0t00 00S 0 P C0PH: )=K0C )K+0A ,([R>KK0C A ( 0 R*,0K 09BUa0 ( d@edA 0-@LPRP K0h0 -LMh2 P!RT"PT!R4"TP!R TAT(K BX! X!R`x!P U T!PAP!  X!V% !0B 0 0B0 XP 0S .R  uK$z p Xq@W"PP u 0PX  0g"P|TP !T@|@ * Rd P!rl XATqP!@XA RP!0r,  fd.& b.T D` -LMpPAK L1\10 <  "R \!0 S 051DH<LHQ@IxD` ExV P1<`1 ?xV P1L`1 9xV`1 P14xVP1PH0H 8$Kk(0(0\1\10 0d.\gyg`gog -LM@KP @oK -LM| 0S p3P \0 T0T 0PP0]L0< 080<V( Kh KF...e ... 0-0L M(0 P0K000$ K(0K e"K@P$ %K0g X0-LuW@4P$K0h}D --LM @K 2 R (B0@K 0-LMK0!CP L0L L@ D 0@8@0  K.0 .e .. -LM#=K M0CC\=_P8  #=K0C@0xP xoKDN -LMM#KA_P KD 00-LMK0!0S@K0h0h hG@P T0TP P0P0H H0Do@0P0( (0,gx.....6... 0-LM K0!P <0< 0404H00 00 A K.8....0$ 0S/ /p.0$ 0 S/ /p.000 S$0 10 1/   p.d. 1-1L40@ Q !0 " !d.0 10 1/d. -LMw -Kz/KK0l0d 0 6 0 P 0008!K  0 N@K'K& d.H H0 (Q0/QQ Q 0d.& 0-$@L0S0k000.? 0-LMhqd@ EKsr EK`P@P@00 0`1, ^/ iK0Rd..ae -PL M@ 0P  K . --L M  K --L M0PP0 @P <  3Kn{X --L M0PP0 @P <  3KX n <-L(P "P  0-L@uP@ ?o00M <0-L@vP 0 P0 0T... <0-L@vP 0 P0 0T.. . Q-ppP`1`#WLP@ vP (B(AGxa9^9VU*P(P-qKh)q0. 0-LM@P @xy 0^ K0%(&  0-LMgEOKDGKPGK Lq gP0000U ($$0`2@CK0.+d. -LML&HA (qt(1P0`!7 Ki<C0 00P00P0H0 0 00 00 0 00`Pp4bq042yi`2d GKX KpK;KGKKLd.. aH &R -LMPP !0@b`ruP Z`P u`bPh 1 PpK01M@04P;@T LOQpKd.b& -L< KhC 0-LMK 0  K 0-LMK 0  K -LM0@0( (0K 0 00 0$ K0 K 0-P@@L0(S0Q nuP0@& -L 0P.. -L M@,Kp`P쐟,0K (K(P'0 PPP0P00 @,0K dPP+0[PpySa0+0K,0[00+0K,0K$Kz.(...H -L,M@8 s$Pf`VPm $zfp`V50S` =tsppGWY l1l!llp ,K !0 K0 !  l080V A/oQ" S  R Qs4 0BPEP`B$Bf`0,K0!00K0!0 0  E00V A/oQ" 8S # 2R `F <0 p<0`As4@p$ f`(Kg -Lp`PP@T  a@P 7/$Kk11@ -L M$eAP`pP$K0$K0!(0K0 @` ( V0B?oR20XP$ e --L M0 0 K9 --L M0 0 K9 |0-d#LR dd#%\0X!T0PL0HD0@<0840d.5`.=.Gd..T .a. P0-L@ n=' 0K0hln. -@LM KA A pv0 1 0K!#! @@u/K{K_mK<@P1: S uKnP n nKG_K,Ev yKAvA A r`Pڬq  iV``?  |1|!||QoxyK1Sg P1 0yK1 ATT OoBSP@00S lo t`  R 0 00000 00jpP@ k}K1C!.x...̤.Qg  F..ܤ.D -LEMR0@S0 ` p4 0p!KKXQ0pS.KKP1 V! 00001S 0SXX2 0K/K@yY+ V ! 00 0K/K.3/P (KV 000 @TRK/Kx R h R K/KX lL V     ..fh.b<.d. 0-LMPQ@0 S S 8b0 000XK0+S  D -LWM$p p! 4Q ` t#ß0(SgP3S0̃`1 @(Tj>3  Q0PhWxS@ A@ hPG|P @80@1 W W_KRPKLP,KQP P IKWppW Tpi^ 0 10S 0S3 0 1S/a0h1 0l1 `1SO 2\TKYl 00 _0!K 0t1 `!t1R R@ 10 1000PXR 0*S R@B  0 P )S  (SPR (K@ 1Ph!d0`  l!PE  0000000 v$ .h.&d.&MD;M00. -Pl`lpL@TUOU 1P  P`8&< -PLMMJK,@DpXPPL D_P P6P  IdP(K DEP D=PvAP `P lAPZ,Ph- tXXaoAK  kPA=K00=SP  X ᨦPi-g-U  P PP/ PP 753 PP DPI8-xn<hDj!# 00-4 LP@s0 PK0h -LHM0@ RK`p0eKSeKP 0S0L KL03/P <0$K%K$K%KPT K\K3/P %KR0 0 %K1/ 0-@L PrP  K0h 0-@L (K0h -P@L0S$Kkp` 0P 0hp00W20#00SY Q0p 0h Ph -L M0pP K]@[`p -7Ƚp $. ((0K ` V(70 t@(T  `wjL(P <P I@ш!0?K}Djw -@LMMpA.K`@; Bg(pP  p_r`a[r`[K -@LP qpP` P  0R P |d zd@ -@LMMA.Kp@; B`(pP 0 @QS`Vr`K edA1  02 RH <0\0 RH @0`0/H P00#P0/(0 0#(0/H P00#P0/ 0-@Lp PHtj000/00/ 0-@L8#8S#0Q400080,08 S0040803/P,000403/,, H0 , 4 T 8 X !Q  0\ SR:00400SS QU Q408  0g40S80S001/S S S S0/000 ,00-S1SL@S00 800400803/P,000403/,, H0 , 4 T 8 X 00CS$ 1 0408 080g -L M14pP37W00@`㬡嬁00 Q 1SQ " Y(K  0SQ'W 88SSSQ R S,0S p 0 #00 0000S `S00S H P00P0 S 0 F`03/PP0 LRR00<R0S 01B l l  , (4 : 000/ -L@P; p`쐟쀟`Vp0\cYV0`l00 00 000 0 00 0 0K`P q8 R)$KPh  H -LCM@P 00CU#*0L0 K3/PP /K oKC?K0ܠ1 0X*0 KL03/Pj /Kg dKAKE?K R0A?KC?K P000 S V0E/K00V 00SA Q0@ apCK `0a@0  1 ! 1`0 PKPAK 0apEK0 `a@H P@`|Kn|0K K5(Kp.. -LK 0C ! 0!0< R 0  0 3/ 0@` S$ 0' 4' K @=K0CX4 a@04 4'004 04d ,KY=K,@K 0C4$4P4 T704   P`U Q PX@ RK.K B@SK.K BUTp% B>K 0C0@0 MKՏ%#!d6@ tv$ O.K BP , K-B D % 5 5OK A 0^JK  @dT 0S  MK4 @⥏0 0=K0C050F0 4S KJKA @F`PD 4[S[$`Q00Q0S 0ENK @DL0 aA 3/P @M>K 0CKK LL 1/KK A؀AYX` $?P4F##$0 0 ^^0F1"M>K 0C@404 N>KMK 0C A P0N>K 0CM>K 0C  P0R 05%MK0@@K 0C4 =K0C4 2K.K0 B4 D y@KBK+A @jLBK+ @eLp W`*U 0 ,MKⱎT B>K 0C0 0MK⥎0 MK⟎44 4$Q030#Q0S 4A4 MK A  K@&p K>K 0CCMKN>K 0C A 0 0@P3/K K0@ A@M>K 0C0P0T>@MK A R0&N>K 0CM>K 0C R0MKN>K 0C A MKO>K 0C A M>K 0C(K 0MK A p.7<A.GZ^ K0CC 0S%0E.KL0 B3/P @4pW<lP  0 p B.Kxp B;7/P BKX@rP<.@. -L 0P. -LM0 /PR KP/R0 R/R  )0e H. 0-@LK0h 0-@L K0hj -LMpPP^P@P  >O`0S  4OU $  $ KT PLP  0sR^PK.{ .j(& 0-L@ 0K0h 0-L@P0K0h -LM@ KV~ EKVE?K/K dK 0-LMP@k KnVe EKhVKpTPE?K/KAK0 0-@LJK0h` -L MpPY`@P P  V0! 4PP  K0$D @. 0-D@L4S0PU0$ PP0T0@. -\@L 4S0Hp 4TU T`040 @. 0-L@P0 K0h< 0-L@Po@ o0   -Lo -Lo -Lo 0/@. 0-@ML 0K@@tFP0K @@LFH7AP08@40AP 00K0h>iP.) -Lx Kh -LMA0J?PU;`$qW 0 P K p`> C  01/P $P0Ό LP0L0$0 R 0S P P 0$003/0$Q<.$ 0-LpQ4̼㛶"T R0/ p-L M(@T@Kp(K0`G0 0003/@P圼k/ -LtM?`P@@) L< -LCMIOK`P Z뼀p0$KA!(1 倴(1S1 1 K xp pPX \\X$1[S  @41K/1..-.gx>y; 0-P@LG1 1  0. 0-L P \. 1-L@`P@0 Kh6 0-P@1L1(1 uP1 1 0G -0LM00 +0,0 0`$0 0Pp 0 @P 0K@T 1K/1T1D 1 P1 1 KTC- 0-LP@P $+1P1   0&)G -@LWM EKYT%@rTb1 TD Tjl20$0@T@T"TT 8"E?KnKPb ! @0 TP2H_PP KP ]P !080!0LP x!K|Ph1PUU0  LPQ{UX(1(1L0P0 !K\Pe(P P0000P\Q Z8TQ O? 0 & F 0  000 EK /@||.&....t.&?5}.).*+00PP O -LM`$c{@P qQ-@T X VRZP( 0 (KEP (0 ?I(@ 1QPo KX\\R T(p04 (K.!S|h//C-M C` 0`pa^Ѝ@T@T, R* @p`@PЀV ЁXЀT ЁX@@UT@P@` @T@D @B`p@PB 00!/. -L ipV   R@C. -L M`X0@Spg0 O\0S0 h `0S|0l i d0Sh0T j h0ST0< k  S &0 K2 tjJ c { -LDM\K&K`PzP(K@P >TX0th0 &5#P0\ 0Q`P(h1!0P0 0QLP H0`d0h0|0\ 0X &K! `$P`PX0 (04H>000 0䀄0 00;j -LCKBM M Ap P@P `>B.K B`;1 pP0 lP((K P 0 0KA C>K 0C !=K0C "! 0X00p`CK; SXe +RQ0 RP \Q SP0p0S RD S ? S S( R0010100 0B>K 0C0C00P 0S  v?9, < M4$<Q0 ! ` "CK L R0 0C>K 0C R0"`l edA 0-L0MP@0S$>C"R0K0 0R* 0!0 ! $KP+0 SS Q 0. 00- LRP@0 C!U00!S @0<00R0( U40 0... 0-LP@P0000 -L Mx1P0`S@wp0QE\\F S?` Ƞ#K(Q $Q,aXQ  W vQ L   R PR h0h dM#KQZ R#(K 0V\!:p. xk -pL0PS`Pp@;S S@* +@" Q pBPT.@T&RQ0000/(Q $QQ 0S T vgL 0@1 00 0TRT Y 圳p0\"1.w -L\MP $K %K0 `0 0`T0 0Pd0 0!$K! 0<K @kPP0S (K#K$K 0$KX0V V >`C V0 0 O1,&K0R`pK#K P0#KK%KR0K%K$KcK$KV0eK$K%K 0KdK`pReK`RpdKᠡ0S + RtRI*`0 PA\Z7Z/QP\0 0D0`0e(Q $EPT0S& Q# J vK d0 Ơ 1 $KP0dK`PpbdZQZ P0SY 4ȲP0TL"M.w 0-@TL0PS T P# ,0! D0R 050#5403$0(020... <00-0LS@DP0ЕK0h.i 0-L@ ^T00PUPU \ST tmp2.`@UT@P@ 0 00C 00  z -L M@ p0PSi T P#0 P `SW 04T(0(K0P 4p0 p P00  0R0\  @  pH `0@8 0'p(0,0`(0...oa P1-0LSPp@` 0QPP: S30 UR r0 0 !Rv?000 RV ^( $0X3,0000 QP0 00 0WP!:` .O -L M@ K300S T ㎱K8 -ML M0@X4 X0S2"K\0S2" `0S2"_ d0S2" h0S2" EKJH JT4[S 808`S X4lŸ C0XBQSS80S @0 K SRPPIPy BK @BK @`P2 B.K B \0d 0`0 00h X }p;S"|v X4h!0B>K 0C\㚺PBK @_oR(K0:R 00  `4 \$ C\$a  `4 D 00C  7;0CSxx0Pp2 kzJ {c { } ~ |&i {     X      -LM#K0p@T(KP`ἐ@D0S UK0 0 01/X S  ` yR 0`Q#K 0P1/P yR.j -LPp@`0SP8p0 S7/P 0403/0S0D03/0S0403/ -L@P`p1S 3/P @`VTt0@d0P0SP000S@000S00000$Kkbk..jov -@<`K0S6K0 St. K0S_'K0S@ K0S(K0SxK0S00$ R!000<0S%F0KK 8d 9/ 0 0p(0@ 0l7)( IK0SV| } L} x} } Q 00000 0J0  (K0000 0J0000!p0X 0J0 Q0 .{}~\Q.p. -LMP` 0pS1 (K0嗏KL0 3/P L2域K 8 H20S4A 0Sa0 0 0 |2K0{2K0P@T 4/@<10 |J?K 0uJ?K ,AK0 R K/K0 |2K0T ?K:/P ,"[X00R0S KK J 0X, K 1BK hF0 010@00'.p.. < -LMP0`0p P0 0$b p0 0 0 JlpK!0L@K0 0I!00 p @ ­ K@Ꮿ/|J@t峭0l!00Kf㪭0pKD!00x0堭p0K !opP0 R T8 PP8Z(K 0`!倭0i KP K <8NT0 0D-`  Y@ NT R p .p.A 1.b i .{ }& -@0L\0P3/ `pV@@P@WP10BV . \ W  0  !   0 00$ 0        C|  0SJCT h0h hhF0DTVL0@1.mh  qz  ky n p-L M`,P@V K 01Kp. p-L,M0P0,03/`0@ S:000 00 0 0  0p` 0A0WKp 0 H -LAM@0K p0 P(K P P0R 0 L0< hKL l@ Z&0H03/40Sb 0/KP @ 0 X0 AK0 0 STj 0 S0010 40 cpP0@" S"n?0" 2G0C 0 0 000 0A 0 0 0兩lK@ ^@ҩ40S\ 00 KL0 3/P K,K`poK40 S 0/K0 q0 KL03/0 儠K0K:/P8 0!/K!)K R 0  0K3/P& -K)K0 0K3/ 0 p 0 KL03/ K)K`pAK`p 0G 1,(/K000 000 V$ ~  -LEM pQ<0PE 0@(  R R KoK`d 089/0 0(0 0``  08pp07/h0 83/(K -LDM@8qDK! $K}K0D KL03/P p-L4M`8qTK 0|%K1/@%K R0@P!T0AƱ Kp0T KL03/P 0-PL@M%K 0@p`%K 0S%U U00X ?I U00SAW0/ 0S T K\K3/P700P 0&0L KL03/P < 800S %KR0P $K%K$K%K`UӪP0Ϫ 08l K00S 3/ Q0-@L@P 0A0003/Pg@婪 K0h < -L,M☪@p㔪$`K@&PP U  00 (  p@@0  K -LM@D PhKJ0`l` 00 }@PZ  @0H03/1`0p>ЀX000 dK40 Jl00403/ 0P l<!0` R 0  0|K3/P: 'K&K'K%K> 000000 060 00 0cp`ylK6ᪧq,0[S l K0dK03/pRll0 0S001$K&<.p.{ \y -L M0@80 q  K003/P.0A0@0K -LGM@P, 0@0003/`P$0I_KS$aK fBp0 pPP0$1[S 0JK0@03/P(`` K -L|M@pD hKI0@00 0$``l@ 4 PP3 P pB0h$ 0 S *PP 0X*0d KL03/> 010100 060 00 0ᠦp@&\0lKp,0[S l4 0Q*0d K@p0K4/Pp+[P l4l0 0S001 K&p `&{ \y -LlM@00t 3/0H03/2`0p>ЀX0Zt 0! 0 ` 0lK3/P^ HK\I&K%K&K%K 0L0 0 40R! L 3/0H \K0 3/pB 0\ KL03/PP; 0 R8  %K1/1H&KP%K0< 80@3/H 0 0\K3/p P00p0 t0U 0㕮.\K 0!%K` lK p03/P P(KP<. -LM5P0S J?0S_U 0Sp5p%pp B`VR `%@T! xKHH5 0@5@085005@ 0F00000@0x 0q⠥p`p>0 : 7 4` 㨔pK $0㜀K`V!0`O00 00 000<0 p,~0$10 0 $100Kx0 0t0 0| @ lKp0 rH00S< l0Ke PÁ ,3 000000 000 0 0lK0D&p` 03xK,0mp0S= S@: SN@`$ KK3/P 0l0 06K2 `0 \0K0l KL03/P &K0 \0X0S 00CS@` 0ST H@P42Q (Z(K@Pd00S^ 3/@@OoBS <0&00<01,K0@!R!@!0d0 `0 @P) h 儡h0S`0X*@P* PQ 0!@d  0T:d0S@ Ϥh@OoBX@`0dT:@@<. k t..~ D R08}z z .z q z .  > -L[Md! 8! SZ/TT @``! 0P@1  pP@M`(K0PP1 yA@?Pa3D!0T1S 0RO d1SE(1SY!SK 0V ,1H4WKXL!!X SK P0F   P#H1L L!M_K4;$另[㌦ 0PKKqKK PU @!@1R"2 P1@ 0S 3/PD10D1 h1D!0STP0$0c81 u0ySX hQ @D X`N LI,H!L0# M_Kj`,a (Q 5K/K` BP BL BL10 00D1  PN B   L! C zBL!:}oBD1P1:0 ?P0 000000 0000 0@Fp NK81S`#P!5Aa7ZUX MK@IPGy z@@a..> z jkI k -P/0LKMMKKp@ I0ITK``P+`>*P '0S #p0|"n!l/~ZP TP  I+@> P:JF?00@T* P/R 00P:F@;jPI0P.$* R"X)F>00B~K pG!4 P,0K44@,4[/Sp0  += RP]K PEBK+ @= P*a!P 0/SP,4[_oPRS ApBK @A0%00 PU+x/ P*BK+ A/ P*PE@E@X(K1 e D -LMK@P  @P K P 0#((R (c(#"c 8 #8SK  -LM8 `IpPP X`P㰐NP3>(K0S @ xT=P08  0KqpLY0P XP@00  /0e  \ -LM$3 `PKAP'KAP K+@"=KK A@@PP.K0 BP.K BKx@lKK A@`PPKL@K+@<K,@.K0 BխK@K+@<K@.K0 B­K@ 㺭@PK@ ᰭ@PK+@<KP@.K0 B 坭@PxK+@<K@ K@"`K@w Ⴍ@P]K+@<K@fpᤁ夑1BK0>K0C @BK@P B.K0 B(^@ TU G$KKK A@PP9K@8K+@Z<KK A@@P K@(.K0 Bt1P?K+@A<.K B$P "v>K0C` dP1 k t     l     J   &e z   o /00/00/00/ p-L4MA?(0X) 0r?@`K` T0T0H` D0 0652H K@P ; Kpp..(. -LM1@1c20 00 p!00  000g 80sP0`P0  )K0壯 KpU K55 0!?%500|%\K00 Ud5 "ݢP5l`K00 0\0K00`0 /iU xK߶4Kx0ZX @Q%ZRQdPRP,KPP! |0S K0803/PP (K0800Sp09&80s $(K 0X:8P0\ KL0 3/P %KKQP TP\E_oRp)K0U3w0x0 P0%Jo0㪢0K0H03/U KԇKYX  0#)K R0)K s>0<,!(K000 000000[S 0 0  R0 0pP^00000(K0)K(K(KP000 0SKN 2K0t0 2pP 0,!<1tK(0cK\K?PP R 000 0SU ?PPp0 吁 R<0Yp &80s ؀  R 0  0!\KlK?P1p0 堐))000000000000 a0  R0 0!Z p0 X (K "0 |?P 0 (KR07 #&000j KWnp.D .|&<.D -LMQPz0Swp@@0 0K0 P K ` K" ="K20 `T0 S!V0`vp`p"&|K"``,0SPET`K0D"(` !";`$"&|K 0K01 0]=!00( XT刵TpK0!(p `0@00+0@080s=0 0 x | KWV wX(KpW pP``p  0!T`K( 0 h0T`K 0 40 0t0S 8q 3/ 0S00XT2 00P0 hpĠT`K0T (` L庠 K` p.My c      p-@LM`(P0pQ-6 *㔠`+㑠0 PlKa@ ݠ)ㄠl K1֠,}0 0F00KK-s0 0KBKp #.0P8 r@0T*U +XP lK 9& }.l x. -L4M@  "(@(0 p`\Q\1T1  200400<1041@P 0,1,00000 1800b"`Vp 0S0p\) 0!,P(EAP(E@ K'0p `BP00T KL03/P D0$K`p0`Vp0ꬫ lH   -L MP`pp 0W,Xcp 0#!0 ?pP[ 0 p@00 1@Q R  f8 00 8, 4 $0T0 0X08@G#@,0S2S P Q 4 00 e=P004 "8qT0 PS840 0S 0S0P00P0X00 00 (Kp -LMp2x`K0@$ľPphPP0(" S{n?2plK0p 040 1 01p00 0A000 00ppp}lK@ V@ʜ40SV(PO p (01噒!0PD 4 0P  b "0 $ 4 0B# i? e?p 8p0 Ph lp90 04040?o21000(K 0}lk<.$ q,  -L4M@ᤑ夡0@pKS0 00 00.p @0[S(K/S  ?K#/0@0K`p0PU0( P p`0c!P 0% (! > >0`40 0T ,0X0 8` 0100"H0 5<PH0 ,PKp%^T P`t.I -@LlM&K4 >a&KV0@&K R0"&K 0'K!'KR0'K P0 0"p7P9x(K*.t70(QP0pQ ",^T ^ 08 0Pttxl0 0 h0 |0 Z(0SPbPp`0  ,4@P80 TQ 0X 803/P0  0, 0( 0R T RR0  0 ,0S0 `,0P E0 0 `,0S 0R PS  v;P|P   p;P R0h00h0 l00l0 T0S0T0T0S0X0P( 0S0\ KL03/P H00S @0SS00\ K0(L0\ K3/P L0H00S K&KP0 %K`p'KR00\ KiP 0RpPH03/|0P|0KY80s !ah'KP0'K 0!0@  BR/0 S0!R'K0#`'KR0h0Y&KK R0(K&KVhK`p-9'K p0h d0` ,,d bp`b" R0p|0`Y 0 hYph 0@p`VpgKYp0 ?T00S$ Kp` gKP`Pp (K&K8hK`0d 2"d,0R`Kp'K 0P'K|0T(3&K R0'K&KeuzK8`0d 2"d0cKp 0R}'KV0   0 'K R0'K@aV0] 'KK$V00Q 'K 0V0K0h SUl SlKp0PP0 R 0 00`00000000) P0ph080s jp` jp`'K :lYKpl呠 D|0h TT 8 r   0gK`VpgK@5`pԆKX'K R0&K -8p0h d0` `,,d bp``h0Y|0Y08 r jp0 P0`.Hl<.Dh.n -PLMp -KPU pPp@E00P0 T>(K00$h R 0  80s0PEPW p 4h0S 00  80s`V p@p 4h0l`0\ K0L03/%K `h00V:p@pp0Y:P@TPJ@pP0 0T=: `" R0P@ 0ppAX[pPP p @Y) 80⨐p0YXp0 XW `Xk:@pW00 T0#S} pP"080\ K0L03/P %K0p`\ 8xP SR$08@H0@.m۶ nJ6   0 80spp ` 8| 4 V0   R \*p \ 0 g1080s0\ KL03/P 0840L0H0%K H00,0%K$@0T0<0X0p@r 0 80sV p <1`@j p-L,M@P60(0S(`,`t0P00 0F0 @ PP`0(PP,((PKp000Ց,I(,`(P00, (.R -LMا )1$AS TP T(!0 "PPP(K0 @0> C 0 1/@P0$A Q 0 > 1/P@P` 0U:@1S<1@1 @0> C @6PU` ,v!p0#Kh&0Kbp&0K\0V$p%p%0!0K 00K00K   00p0 0K 00K0p0K  0&o00 0K0 00 0 @ lK0 g7V0l0 0 6KP5l0K`0 \0K @%` 0 (%P  (P  %,  4lK 000000 000 000p` 4K,0[`V2 0FSL(> *KP A*K 00S KK3/VRjKԊK0<!YX803/ 0lK< 0lKd@`0hQJPp3V`@PHP0l KL03/P \0X0S 0S`PV003/PQ  01/ 0S 2"/V*KjK  0lKlKaPPlKlK Hp0  Dd0 h^60^< lKPPnz`, R0 3P0 Pp@H0l 0H00 KL083/P 0l 0d0 0@ K084/d00DH pDP 0,QQTQdT V``XQ 0p p@l0 KL083/P 0l0d0 0P K085/d00P  P h00d00`00\0 0+P} 0lKd0 `0 O<.t.p408} Ȫ .ت q Dq o6  .-L5   --L5 0 ,$! (! ,!P 0! 0-@P`L4M#ߍ@0S $T K0dL03/P #dK 0 `#8PXV` K R00S 0 // -L MpW`@ 8 0 呣, 40P002 5 r pP0S(KQ,  R) 0 #0S Q000 0 02 b580T 0 哢"0 4 00000S p  pT"$0!0R!/S01/x.!0 /x. $10-SL@ x1SP $003/K0hx1P$1 0S -@0pPLiK,`FGMM{FD7J0S  0{CGK L@05 G . -LN?  AB}CEF -LMPH`@@ GK*V(d $ L 0D`qK1K @0S GK GK8`V#@G?K P 0`K(0St GKݳ@d,0SL GKӳ@@00S0 GKɳ@Z~  1}23 -LM0P@1KQ* t  ( < P d x ґ GK* GKq0`N 0S (0S GK GK,`VG/K0K 宑 GKb* GKlp0`N 0S (0S GK_ GK[,`VP厑$0 Pㅑ 0Pt們0Pd{0PTv0Pq0P0l 0~ <     -̦@ PqMLM0G P 000x R0 00'P0pTT,vK,sK8`  0@0S D` P̚ ` ƚPs%K%KpW00(0S rK% @rKbK% A @00,0S rK|% @ԲrKbKX% A @0000S rK@% @IJrKbK% A @0/K 0b.K0 B~P+ tx``!R00,6K<0rKSn0y0$ @⚲rKbK A @0rK00=,0d$Sn0y0 @⇲rKbK A @q00$00;8rKQ40 @ $srKbK A @]0rK00=<0#Sn0y0 @`rKbK A @J;0 0 R rK# @MrKbK A @7 m`0 R rK@# @;rKbK A @%x !#0= 0S rK" @(rKbK A @x`0`00=$0SrK" @rKbK A @0``m(0S rKd" @rKbK A @x !#0=00S rK" @rKbK A @x`0`00=40SrK! @ٱrKbK A @0``m80S rK! @DZrKbK A @x rK!#0;! @K"LB_K0e/K0 _?K20S 2ZKT1 0P1 2@L1 0H1 0e/K0Z?KD1 U?K10S K0e/K0 =KapB0 .}/@"h!0  .1L!0 S@!0C 1š(K0 1 p. " 8 $ 040m0K/KL03/P 1S !_R0k 1 L. " 8  `@p040pS.x. ./e . T"d.o,o/`.To  0-x L@$.+0 @0p0\d K0h臘 P 0-L@.000(0,0000Dd K0hoꐯ -LJM|A`0Psh!  0 Š1SC吇K@0P 0PP@0 廎p(PoU@@TGoK0 0 00`P衎`P`,P8p0PPp&q56}7 -LPM0a@0 $0@sP!  0 (U$1 SQdp|@(1@$K 1 @K @0S$0ö!nPoU@@T`   @ T t  4 X | 0 00 P0PP  0/S  GK[$G?K!t(@@ 0/S  K1?o21QU|1N0t,!@<1(0@`1?o21P 1?o2 1 1S 1SIOaoTPPUGK0 00 00p_P _ 1S 1SJOo 1S 1SKOL` 1S 1SN,` !<."#}%& 00-SL@@0S000 @0S0/ 00-SL@ 0S > R0000 !0S0/x -Pp`L]MԂQ 2P2@D] U(K0W/KL0 3/P1 L1.DZ+ 0S( ]K]K&',0KI1P/S 4]KH0]K0 01 1SwV p`  ]K '  '1S1 0 p`1 $ 0 SAT2wV 1S x1S $! WA7& 0KK0D! N@41@,!Q^K❚1S  0Q ^/K& q 00!15:% P n Q 0, ($!` ^/KؓP\ 00 8q4a101R/.De %    -L0M@PT4`p!PP 0T KL0T3/P KP000T0SX0`pS@, XT $0Sx||b@ @0S00$K@D&7!0"/ -SLM@pP 0#00K❫pK⏬`P q/KXXpT3P /K8i/K0! $ 000 ,0 0" P0S, XZ)00KK42 PP Tq 0 x0K/K0 C"T0S `㋏K,cK wx0p⇞ 0S KH KD`,pYV KoK$ $^0c 4 o/K:0`0" /Ko@] 0  K0Sa  KK9 `pV H 0  KKN1 PS H9 0  0N 0S; @0S@& r0<0!04000KK@0oK$ 0DL03/00 R,K,K,K0S 0t!KԨS4/p x//} -L4M`$pP@ QP@0\ KL03/P L0 @P$ 0S(K 0SK010.\ @\D\W @  @H0S0,0Ԑ @PT R,P PTZW0P0 0R> S|08P0p @^ B @YdYW0@0 R<0S@4//C/ d00-\0L0P H@P00QSP0!RQ.<.. -L0MP$@0L KL03/P T0 ƒQ  RK dKƒQQP  RR$K  0.0@-<^`@WV 0S. -LCP R 0 H( 8#P 00 x  g -oML M C  01/P 0$0>@CP C<. 40-SL 0 ; oR % -pP@ᘐ嘠LX0b2US40S00 00 S40S0|1 @ S$100S00 0SM 0-L8M@8 LK|T P $Q3$00SU LKJ LK_LK⠬ 00 |10K0]P GP Px. -LM`8 \KDVP KIP $A003/0 R   01/PP 003/@P$Q0H03/0 pPKX^ X XU0 803/P  0<0S KK3/ 0!!!5# p P0 K3/P,K+K,K+K0K0 3/p 0 KL03/\Kⶫ \K˸\K pP 0SXp@ 0 |10y0 0 KL03/P 0 x0RuPp0 KL03/P 0 x0R (K KQP  x00p 0SxPx.; o % -LMR`@p PP xq_K, K4"` fP(KP(  4 p0S  升<08 (00,0 000040!04 04$0D0(0`P oW h `xh20 & tZh h h \ h Ph Dh 4 Ԫp  Ϊp [ Kᖪp 0P(a0CR4"`"f `)`aVfPb 0  *0*0P0t  0* *d@edAzd@ -PLCM M`B.KpP; Bp@P E>K P0C)PULT!P0#  K / -LK0C @0@WKA VKA Xe t#P@ 0PK A ,UKhU 8 KpPL%H 000 0SRK @PN=K 0C VK 0A d5<0L50@0L51800S UT 0@% 6000T0S!@PU %=K 0CU 0Ph5 ,5[S RK  @RK  @RK @PV>K0C  X0WKA }RK| @P=K 0C  0UKh5Sm RK < @JPR>K 0CR^K P PE@P DU>K0C R0& .` D<P=K 0C #00l5Spp&W MP``PPX5SX50@@ 0XE 0 0.0\0嵳 0!U>K0C !W>K0C " 000B.KD0; B@P0`VS.K BK 3[ >K3K 3[3K040K 030K 0  0S0sS@04)  H0 PH0  p0lS@h噤( P  p m(K@T@Ts -LDMpP<@K 0S  o (K-0K 0.0K0/0K000K010K020K 030K040K060K0 80KG P40[ R 0S P0L哥&@0 P@0:PUvs p-LDM`P 8@ ] @\K@ \K6/TKpsG-0(pSGg*PBQ] Q^rq`h,`QN sO`@SH@`#`3S`#V; . DQ>*t> 0DbV3 B^: ^QUQ3qrⰠ ,Z& QQ!sOⲐ@S#3 S#^ IQ*0S*A\!^PU\  S*A\!Xb0Ѝ0 SR00R0S 0 $ 0( 0 ,04 8<R#3///A-!@RP40B 01S+ \Q  SR( 00 01 SR Br_s? 0Q(`p qO@PH 0`pB0T0 0  T0"\Q0D , P 0 S0/H/P P P P/ @P/PP*P/P P// -LMp@0  !R Q oό4  p4/ KR\8" 0SPU"R P  `aV U VX Q0oό 0p0P"/ /0 ꨕ0 ꘉ -LM0 0 0 0K K0@-O@@ TC "@PAL@@@@@?@@D@ P@D P H 0$b 0#b 0R00@?A @ P @ @ @DPH A0 -P`@L,M @K]D0K DP ,@ >PT`0 K#KQP0P cK`1/T 00ꜣY -`L\Mx0 >0p t `0 <0K0L0K0P0KT K`lP`#KL@R_CK40K0@0K0H KD0K`ZPCK@Pp T?%KX\#K?!\D8 <0A. R0H&K T0_d0 %# J0PdXd \?!\d,T0 0hlQ[ K0PVuW d  r" ?~ T1 0@>`C0R\ `p ?k 0 h ?$(0@SR`<0K0L0K0T KP0K`PT0SP #,\ 01" 0L0#KQP@TL0p Y0t0Px0XYVE(K<./ -L M#KcK4( p40,0 \ Y@ \T PR@PHR@PUT ^ Q0 \S40,K000( K40P($K -LLM`܀V4 0 PP T !dK`pdKpBT@R00p XX0 0&K0T000T W0#02SE 00X00 K 4K04P:4`0X @0@K 0  1,(0R  `BZ0`J4 0` 00 0 K40 K$K$KR0KP0  #K p#KK 0P0(K 0-L0M0B"T @PA@P A $KrK0000C R / -LM 0  0K  k K0 0-LM 0  0K ] K@ -LM 0  0K P K/ 0-LM 0  0K ? K踑 0-MMLM@0sP0A.K0 B;0s NK @9NK @rN.K B K0{dЀ4? -Pp0L4`@ *0SD10>ЀX0@(@ 0 Q RQP YXW @1<<1@0S BT0 0"Q 0S ,Ko讱Dm@冕P,mᚕP1<<1<. -LMP4@p!0 P- W0\ P\' P"U rq?`0h2岀`0s  PP \80 4 P4 80`0(KpWBTUD -pPLD|| @ 4``0Ɏ 0 `. D@ 80p UWZ*  @@ @H/Hu. 00-0LSP@U U\0 XU000T T0,00 @D #.(/,2/RXH/ 00- LR@0. -D4 ML @0  jtl p p0d (@`0p @ 0 @嘡%@@(KH/oa . H00-0LS@eD0(! R 0K0h.H/ -@LP0   04 8 <`p` 04 8 <00 00S00  SR000 0-` @LM#KPop1S PUBT(KU  (R  SR S"0` 0㓥!2S R02Y0(2 0 KQP 0-L 0D@P0S4k00S00ӵ0ŵ0P00. -L @`PQ Q OP  _{0P00E00 ል0Q  a0PQ/So/ -SLM 0 0K K茈 -L MP@00 `؀  P0 RQ 00Sl   (K `F&4 0&8 0(4 0 (800` 0&l<< ( `0. -L\MP\K@`pr0PS3 0„\  \^V 0SQ00Q0S W0l0 l(KkKR 0E  >%1#R  0%K40p0 0 Q VX QP08R  RW$4 0 Q Z QP V 0ZRUp0U0X 21 SR܅K%KK8”\%pPT0 `0 q?r l0 0\8"`0"HRQ0d d 50` Kd0dKPMW 2l` 01S ^  SR q?r 0s(2 0PXR 0&KR0^œ"!`VR  l  0S$2$"$$023%KR0W? ]j=d0`\0 %KP0X` Kl0尀0o"0\K0Pl0 $ L0 d02S02D0S qPS D內@0S 1< R0!p0S q?r0 8S 0 [%KԅK ^\ P0 ` p0~Ȍᲀ  X00 C "( W> ; vS. xsvkA-pP2uSvw_10000“b\œ@FqL@$H @ - ( vRP ‚!S Q   (0  vR S 00SP00// l0Q!R0-LL0L HR€;IPT0@0020>` v. -L8M P` Q @`qdQ2"@! P0 * 0S$ 0T KL03/P K%Kp`  P`Rp R"&000$K<. -L0M0Pp` 0 9@P0 00S 0R0 ! P0"<0?020x 2002LKtP @02<02802D00HKD v. v> 00- LRP@0S DH^00U0S^D 00"0"@.H/ -L MPp @`@"09 0 $ 0( 0,2Q 2R0 002S R02S0(2@ 00S!S8* S S4*SS=*S-S+ S0 SS$ S! SS S*  KS S BS SS S S00S  CR  0S0 S S000 @-LP꼗̗ԗܗ Kh 0  ; w. 08S^a/H/@/ 0-L @ ( 0vS0PS 00Sg 00 0-LM0P0@S KoFPP 00S T 8gK0D0 #! R.H/ -LONKNMM @D`  P j``NK 0|  @qB.K`;` B WpP <ϔpTQ ;(K yd -L|MP Kp@` P@F0K!@P 0S X 0 R8L1L!LL00S 00(K (KP0 0S0\ KL03/P K(KQPK(KQP 00   x@ 04/@(KZ:Z ZY X  @Y@  ( vx w .  R -@PL_olUKhf -LM@P0 0pK0'4Po0S  `VRU p 0P 003/8_o9V5Kh1 wj . -MLM@0P 003/0A.K0 B;ipP pṡ`P  2 ^K 0-@^LP8Q @ 2"0282w -p@CMLM`/@4 B.K; B&0P44 0 i0 L$ H 0$ Y@#;$  4t P!14"S> B44S zo@ U01U01 (K +PP =K 0C 0   4bt CK? A 0SY 0I,tტ0CK ASY 04o_SP 1 SR 1S  RS1S1S2pB@?↯<4 Q [<4 SPTJ 04"0SE04S00D04 P= 04`0D l 04 8 < QR@ Q@$ r"0@$0 Q031 Q 044 8 <" 0'D D40 FDURX -L0M0Pp` L1L!LL㓠@P* 00Ǣ 0R0 !?020 20 0002?4 p@K9 0S0"P00L KL03/P 8P fP003/D x. > -L P@^T@@ 8^ @T$e ` ` `b` ` p Pp`" "0 q`0`~``Pa Y0p`T08BP082@T^ Qp`82S4@0 8~<`p0hx R  @Q" "40T8P 2SAT8BT0Su   -cML M86 0 QP& B.KP06 0; B5P@(Kc.K4婑p 08&PF<6 P6@ 2bK, @D6 D6S rW !R2"pG.K  `  `  ` dhl#V!bK Aaaaaaap@W8C.K Ukt@bKp` AVrPxBTۏQP < L& D6 81b.KZ 1! B,?? <@`8T1V`!a&a??``aL&D6؝P<  0KA 0e\6 0eq'X6 e>KK 0C A 0    qK?AQ P0EbK, A=K 0C   q =K0C S R @d@; x. U -L MR@U|0| ||+0`0P \ e"{PD04 o K $x.   -LMp\K`W00P|8|(||}PWh8< 0@(K'K2TQ\@Q\σ~4<0K8K RԈK40x0 'KR000X 00S 0PSWx7 0(K0$ &KK'KP0K'K 0KP(K0 *K 0)K(KR0W>8B4T%@2r/0 q?080s?0 0KR000TQPM)KR 0PHWH6u u?vτ0'K 0KRoBo_P0"\KD0S SP Dt0  8x@ U x0x o?0 R S RQx 9 0^(K㌝`PW50c%%? 012U |0 0o_)KP#  ԉK|00X0܆K@PK0 20\KD0S SP D吟B|0܆KC)K `|, 0 0)KP0 K܆Kl 20C K (KR0KKP K0 \KD0S PS tDSx0T82SK0"P0 @Pyt0#2? 08B122bDTW (K0"200"P0, K40"0 0d 0dK04P `PU0d0 l0 0%K0PSb0 F 'K&1#KR'K%K%K'KKl0P%KU0KUK40o04"\KD0S Q<PS D͞<@B#38d0 (1 0dR !R  "#(Ro_x0PP 0SPo/ @T \ `TV U \ QԉKR {wτ \ KO 6x.  .Uxs -L`M@Y`p 0P 003/0PU_4T KP.Y) ( LK|"V 00%K  dK= P &K%K%K$K0 TK@0 }T K P$KY K0 0 %K1/P0 (@00S $KR H %K @1/00P 0"P25/0P,2/j -LdM00 SQ H aDA0 P|Km| KP0(b|KR40@>SPA0 P|K\| KP0b|KA40@S`0p> C(KK 0R(KK ? ?K?Qd@P\ @`@10d p07/0@`P(K}<. -LM`0p048!PAX@@ \^0@RX d 0UP࠱ࠡ? 0^  0 (Ko/<.> 0-LM@0 u410810!1`0K K KP0 0P0L6`0K K K>0PU K5/_K0<.  - LS  Kh膋 -LMn@/0 00s (& 0-D@L0s,00p o0Co0&I/ -L MK,K 0K  K 0-L0M$ K< <K80 40 00 ,0 (0 P$ K -pLQMUfn "OOKed5 `pS?K`!PU?K 410CS P0UK "SKR0 ğS?K " 0UK 4 @R z 0S^ xP[ KK^o40S@ JK|$@@l4`V08S?K2 L4/* 0 ?kdP`d`KK0d#ڀ3@p3Wp-pGP apGWd#0 #pGKK dp#彀@S?K P࠳ࠣ\^\H K?K4#d⢀O?K` `Vp@04PZ V0`p= ⹮ 2 0 ᨱW?Kp2QK R0 0uP Q?KW?K ɲQ?K0PQ/K`P  S  RfK/K"QK10 " 01``pV0d`Vp`p`pdP#ᰁ/ ` 0p&%@1+ / 0 QK``p&5;G%0 T!%1@`V0a0QK K?KP R0d WK 0 PS?K V0@ DZ"Ce 0?D!@"% +LŠD! @ 0Q/K0ំHI/xI/XI/I/KI/<pI/Y@eI/ lv.AI/I/?~| U?K R0<  @ZK?Kd` @h0 0KKp p(K0 VQ?K`pW?K  0W?K ǰ0`P0P !@`<K?K<P|d0P!s@d!m@ 0-LV@R@0 -@RL RF700Pp:@`W:00WP0 @PF1 -L M@pP`耟0*@K(0 0S -S :S S  ,0K+K00P  0  0@0( 0R ZT0S00W  ,KgpG@ K(/|& -LMP`P0@# pK$0 0'0 $KEwp@ $@P 0S$0%0%*P@ $ 0S*$h|K跺 -#MLM@@K0A40 9p 0 R K(/D -LxM$Qp0 K 0 j0`t0"KⓈp@3 えp.  {p( up"  op (㦖0P ` @p  $ 00< 0R $t SK(/D8    0-PL@T@ @T00 S $  0 0S ژؘ0 S   0 0S ˘ɘ 0-@0 S   L0  { K0h谘 -MLM8q00!CK 00 ۇ0S0 0R< F ,0K0$CC>K@PT*)>K 0C @ |`P` @ 0 R 00>K 0C  p `0S 0#S@U@Y700(K(/H 0-LMP@0$0 0 0 0 0 0$K 0 ip 0S 0#S oK00 S   000C000$00P0$PS0  \ -LM@Pp p` j 0W0 h 0FKU00P PhY}3$ \QO$ -p!LtM G/oP`0"K(0 p@ KKz KIp )Kp@( 0R wKtp 1S (p @0W ) Kꉈ !KZp K(/ .0-L@Pp00D I U 0 p 0 ; 04( p-LtMpP0 K 0 _p@ KkK Ɔp`Ć@ 0R Kp(/ -AMLMQ@ӘP0p00 `ڥ7000 0R 8 <  X8C>K/@`V CK^(K(/ -PRL`p @ X 0%S @TR' @0 S $  0X ,R  pPP00P @ @0 R Q*U*  dRC700  㐕@PR U P Pٖז  0-qL@0 000 #-`p0L@/0s` Pp``q j 0p0@p`PU0 S   0 R ቖ`3$ 0-LMd@P0$0 l00I0KQ0p4 0R  K K0(/p h$ -P`p0Ll0@TT 0S V P @ Kh$ 0-@PD0QL1l]0UK0hC$ $ ] -@L P,`|l080 C0llH, 0 0 8 `| lD #0Kh $ $ $ p-L M@P#l000`V Kp 0S 08 BK K B 0 -`p0LP@ @Pp$KkH8 宕@H, 0@Wp3 D D p-L M0P 0 0l0@T K 射P 0 F 0al0@T0Kp 0S) 0 R Q H R0 0 \P 00 0 kP jP 00 0 0S h1S }P 00 0 @ 0S .+p @ D0-SL@L0S)\0S4QU?DQUILQUSQUaVT!a1CD00CD0D0HS0H01CL00CL0L0PS0P01C\00C\0\0`S0`0_ 1,P0C 1 aVaRH1,P0CH1HaVDݔDaEP1,P0CP1PaVLДLa81,P0C1 -LM@0 PP @0 0<0Ѓ0(080Cph`Cpi Cpi`C C#$Kk($K -p0L#h0@l*H0S D0S080 C0D0S SKh*$ $  00-SL@0080 C0 D0s0G080 C  QPFkK0h| -LM`p2X@؀D0 0* D$ ؀D 0  ! D؀D  0 0  D 0s@0 0S D#K 00 0 0 0#K 80܃KD7 D0*X 4㨁c(#"c(,K! =Q % < P0 ' < Y  i  DDdX= D 0 0S ZP`` iP, (K 0b"!4b4#,K0! d&   ` `0S  `60 @d6S@`p@ 0-SLP9080 Cp 0`0$0- :0)P 0 P@@@ 00$0 :0 X 0 P@ 0$0 zW@`%@P@ -Ѓ: $0l0L`%$: 0 OP$9 0 WP$: 0 `V0$0  : 0@Y 0  -LM0c@ %0K0 t0 0l0P #0" Hl  _%P P 2 P D P{PU%P P1P4 0!c 00)0 # $KpX dpP P  %K$p<@F $0 #6ș P / r$ %K 廁p# p  征p` 㝂ᚂᗂɁ# K% p $ % 4% $ J% % % S% \% p% z%  -@Lx c0l0\`PUKhZ 0S~(P0$#Kh]9$ -LTMa@0P(0 l0S 0$I0@hK+p 0h0K p0h K1P  i ( 0R UpP @ pI Xp U㰀  @00<09 K(/5 % % -LM@Q`p` R  P00 0 WV L $Kk~$K% 0-@L 0S0 0K0h -L(M,Rp `l( @P| 0Sy 8،0&0s 0Sp V"H0S$pN0`P v D0sb S  $000D0'$J L( 0R@ $p$0A0AS`$0 V?D0S<   H0D`S lpI` 0HK"70l RHK᣻P 0@ <y'RffY( 0R$Kk$Kkz( 0R$Kk( 0R$K(/ & $ &  -LM,`0xP00 E-K 0@  Dqh Qo -K+ 00 0d0S JP\ 0h Kd[ E  0n E 07 Zp Xn E E E 0' 0S!X E0 g E0 8y 0S؀E 0 6 0*yp = ,0 0S SOP 3K T 00 0RI ?Q/P$0A0AS 0,K1@0 K0 0$ `0 Kr  d6 S}0` 㙃#ᵺP 0 K0 0T 0 @ (K(/J& u& & 2& R& ^& 00-#@0L 080 C0 AN p K0hJ } -L MP`@T(KpW4 nP4   U W R @p RX 0 80 C#K)& *#KIx@OW   :& -PLMP@5 P PP PRX!XX.< T00B0@0lKP# P- P< ! P P ph0Kh P l0@T @x xPA8,p\KhPKh@Kh g] & & & & & & & & & & ' c ' ' 0-L@.$ 0K0h 0-QL@0  0S0K0h -qLMpP@( $l @P|00$K 0S w,0 Sl   0P(0K ,K3 PlP@P N0P0PC l`P 0S ?$0$0= = =0S ))@0 S   000l0  @  0S 0@ <&U, K 0S vP0 S   0N' m e' {' -@LM> ^}1-,pxx# K0\!5X0T (K `Pl0   PpcP 3 Rp耟PU el( Kl|l0 S   0l@P  0!l0  P  0S Pp 0'  ' L  0-L@/p0w07SK0hxo0 S k0VS0K0h -LDMp@0l(0 PP oP T N70 0( 0R @=0)`S AP <0d K  ,M=@  K(/ }' -L$MpP|@,0P h d%`P 0,@0 `(K `P 0# ^p`Ppp p` ```pW0P Z)``Ix<0 <0| 0Xr#KT`0` 00K0D" 0fp"#K :0X 0S1#Kpq` D0 < Kp < 0p0`D0nP NP` kP#K #KpP xP#K:#K*cKp`dK00 00SlP 0S cK A`p$K0`A00000 0* AV 0Sl0@ 00 00SlP 000@T*0 0C0 0l5' ' ( ( "( +( D& @( -L4$@KM`0dp P (042KW@ZT0 T0h(("4h#$K! @= )=@$Kြ -LM0p0`00 d0SJKPP6 U0d0@!2; PUPUR PU P^P PP(P`P(\Q <0 T YJ0 P-L0 0LH0<0 k mJ0 -L MpPx1x!*tDp !yJzp`D@(K8@ XAPP  0 R 0pT@@0x@ញ0S4 C   0Yもp @0 0 pp @0@ <0 v J0 -LP(0( $48 <0@ Kh<0  J0 -LMPP`0 0p@40 00 ,0 (0 80S  4Kpxp` K4010C>S@$ K 030<0  J0 0-@PL0 0 00 4080P PP$P00 S (  00 S   00 S   00 S   0 0-@PL D8xK0h܈ 0-LM$KSyp@K0Ps@P P0P0000 P00P 00$P(00L08ypD@ p-LLMPP1!0aH0H Rk,0S , 03/@T0S^ 0 0@D0KDwp?0S ` KpdKx&KSR\\\ 0 S   003/00(00@(@PP0\ K0CSL0 PK0L0 T@KP @ R<0@D3/,0R  R 2/L<0  J0 ʚ; -L M 00 $@ *p t@K(& -`L0PFp P ڣ# "P  RP@@#C 0 0(@0   ᠉&(& --L M  K -ML Ml@p0P(0 (`BK0 @"mbB.K0 B$( 0R p K(/} --L M  K --LM  K --LM  K --LM  K --LM  n K --LM  K --LM  V K --LM  ~ K --LM  > K0@& P-L,0 V00& -Pp@\`LV`0P@ 0-@PL0AGp\NK0h 0-@Lp [v0S0%K0h 0-LMPd@ 0K0  K00 K0wp9[ $00R K0(/i -LM@p 0`K 0 p 0R pR0  K0P K,ZKwp :[$0K(/i 0-@LT0xFR@ 0-@LT0GR@0Q/ R0 /R -L$M`P@0'0S  P P P:O`P 00K0!0 0   008S0 000(K080 00S # `p0PKP` 4K 04P 0iS.S P` 40P 040:S|& p-LDM0@P ` P Q@TQ00\Kzp@ 0R V LK RP @0SKp(/ -L$Mp`@Ta@(K 0S P P0S S @ R P0 P E0S 00S㺀000 HP P00  uN P-L000QPl0P/$0/ p-LM`Pl@ 0K 0 z K0@U K8P 4v 0pR Kp(/i~i -L0MPQ0`(0 0p S@ S$0SRR #PK 뾔[0 00 Q@Tl0@T"{00( 0R υ)S0.S /S R W R $R <K,0 S @$K(/ -LMup@  0K # ( )eup~K 0 0-L@6#p0 !p`0 -L_M1 5! 0F/`PSK00 9<1 IpPP50 0Rb cp|Cᮄp@! p 1S001 X 0S 0SbK0P1 P ^K P PU1SMڠ1^KPB 1PSP@L0SP0 ^K4PGL0SP@T0SX0 ^K&P;T0@COoSB@TP@D0SH0 ^KP*D0^K@COoSB@TP7#P^/KJ1SPP1s1^KP#0PP@@@10S1 D@T^KPA  00P1 ^K"0PP1 㦂@POs: ` ^K 6 0Z$0Q  SK- < MK 9<1 0S/K1081 tp <1 B00 RR*R R 10#U00SP A 5R R1S P0R 0 R R0(0 = 0)j=)(P!=0Q0R0S D0S NPP#0000U0S !p "00@0O"p0H0@0 Pd0@0UDP "D0000@@@(K(/ 0 i%1 0 @K1 C-@$0R ؀Cpe  @$ P A E@ @C؀Cp`  pn  PK@C؀C`p  K"Z@C؀C` p  AY@ClPA0@ P 0 A -LMpP@P$K$`Kℐ@& P ׃PX  \P,z0P   -LMbP0@00 0p"S8` 0W"SpGP Y !0@s`P700800 0R TYP T00@010KW YT X0#0%* X # 3T R\Q``nQ 0Q< bQ QQ ` tQ xQ rQIT  T  PT 00 @T 13 K   4K  ``3K3 [R) T'  4K2K`P2 K4K`0PLU R`2 [R T  4KHPPT T@(K(/|&P /0 S S /S/P0/S 0 S S/0/ -LM0 4 Ղ`P@(K=@P \\PP8 X7؁ ᷂`P  Z@P< 1a 00@A ā@@ P0  Ề@P0  0@ 0 0P400PqZ 8  P40S t@P" W1 -L`H p @PXD! H!p6 0 t60 00= 0009 00J@0@  PL! P!x6 0 |609 00 : 009 00J! !h6 0 l60 00 000 P00p@m1 q1 -L MpRP` 0SU00000VK/P= 0K 00 0 @   0S V <PU /P| T /00DV 048 = 40 8 0TU@x1 1 p-L$M$0K 00` 0P X$@ T |0`( "4`#K! Kp0 P@P00P@@P@@ -@P,pL 勀` 0e SP,p傀$` PP(0e S$y0(0$0PP -LdMX0 0\0 0pd0 >P0@00 X010CzS񟗚>++?+4?++++++++++445555666,7H7\8x8P8PH9+9PPP=T>+>+++++++(+D+ ,(,PPL,,H----PP./P0H01l113P@44+*`@?@A4AP+AAAADDDl??@DD EPDLMMM NLNM(NP??hNNNNPAlA4/+PODlO0OOOpTI `Pp DK`PHT XXP T6X T&D !@P<0 0 RY dX, Tq X  <P 0 `P a v<` 0p 1+}P  0 p 0S P 0 1X, T8  BqTx, 0 px P 1.S 0 1@AP0'' AT l  0_p@L tX BpT Q80S8bX, [T 80K0 0 0 W80XSu  DT 80K0!0 0 80 S_ < .T @0K0D0K0H0K0L0K 080K0P0K 0T K<0KM00L0@0P 80<TpPPD000P 80<TeP 0@00P 80<T[P& \UTu @0K0D0K0H0K0L0K 080K0P0K 0T K<0K00@0@0P 80<T7PPL000P 80<T,P0H0X, Xp IP GGTX# 0S /S`P /N`P00 )V /0P0 P,,,000X, ~T 80K0!0 0 80XS (gx?0 aBpXP ?cPX@?30?KT ,`P 0S<TA 0 ApT.X,@ &x  0@4  80K0z,08@Y0 d`DK@ PhX 700@ A DKC@40A;A@@dPA[B@40@@ 0A  Cp PX؀A pdT`A P 4P 4P$: A06S 06S, T2 80K0 0 0 80XS T QH DCHX,`plX, T `Xx`, P# `<` zpPf04"b B}YX,`plPX, IT10X 2BdP0X 29 [P 0X 20 pRP `MPX # @~X, X, 0hT3  00p@R, CX, X, (/1 1 1 1 2 !2 =2 AZ2 d2 k~2 2 ]6 2  2 2 2 2  3 3 -3 93 F3 m3 f3 \3 Y3 u3 3 3 3 3 3 3  U4 #4 34 M4 |4 3 3 4 4 4 4 5 5 = 45 =5 &X, X, T P@0K0D0K0H0K0L0K 080K0P0K 0T K<0KL000P 80<TPH000P 80<TPz0@0D0mT P@0K0D0K0H0K0L0K 080K0P0K 0T K<0KH000P 80<TPWP6T =PE$ 7PX0S P 3,  ,-  P   P PD   P  P  P  P6 `P0Wpp @KDK|p 00 8Ksp 00 P DK@K|X8K8x L P  A P! DKLp  pP ,`K&WTXDK8P $ P Ab PX  P80K0-0 0/ GS80S ~ q`P%/ !@P`` @=PT00f 80K0 0 0 S80S R AL @KDKP/P0XL P@0  TP L6D P! @0L&0- @KDKP/P0XD H@0 TP D6D H! @0D&0T Q6P LPX, X, 0,X, 0,X, X, X,  X,  TR @0K0D0K0H0K0L0K 080K0P0K 0T K<0K0P0@P80P <TP 0SL T* X\dzC{P\T QpX, X, |X, uX, nX, gX, `X, Y U00WppW IX,0,P pT /pP004Kp$p< |)p 40[dX0 30[1`[\0 20[``0 Q, RP dT d& 4 [`Pഀ 30[@020[010[000?o`2V``V0S$ 00 T 0^  ^ ^ X\\\`\0S/y@P` @-<P   T 0S80K0x 0 0 lQ80S H 00X, TX, Ao⚏ Ao'Ak➏oAk⣏)n0\ X0d 0d0`V `\0S `T X `\0`V$(`P `\ \  P80K0Q80` S  E@P =0`0 pP0:0pP  80K!00 0  P8Y T{=P |JzP @PpPb8zPP@PpX )zP @PZp(A4zP @~PVp/zP {@lP\pyPP pyPY \yP\DyP#PZ <h0 h0   7\?o2= WwyPS yP yPP yPP lyPP XyP P DyP@P 0yPX yPT yPU |yPU \ uyPU oyP\ iyPW cyPW ]yP\| xWyP\v dQyPVp Lp@P0(0?yPRp xpP X0S0@<0 , PPAw `R  R 0<0 ,0@ <0RRT  @00,0"0@0 0$0(0`0Y` 0  p   p P < e exX00CS$3 \0  d0@T" DpP0080K0 0 0 pOO8`V@<@P$ 0 fpp 0S< :wtP 0 TX PPP #wb<@ 6< &!倆TT XNX606H0X,`pl?X, 8X,`pl/X, (T [fP0 1zX, X,  T H,XpP G $"P PGX, X, X, X, TR l0 pXA@T 0Y0D  wT0 X0Sm OPJT5!(KV5 Ol5 j= u= M75 @5 5 5 = ?= F= L= T= [= c= = = Q= = 8= 4 = = ]5 C  6 6 " :6 xU rU BV6 3 4 -PLM`0p @00 280 0P 4 ~P4 80 PcUX(K@$0SW4 00 0,0p(Ko  |6 \ -LPtP~ fp@ D 0 D 0+ 0,l0l 10 0605Wc0*0 D D0 DD 1  -L$MpS`P@5 0Q  80 CKᴐ崀#000K0 0  Op0   l    P U ,dz#K 0,0 (KD&?( @(  0 -`QLpH1SP:1SP?l0PSC  1PJXUuHSu\QuhVl6SBhKupVt6SCpEuxV|6SDx?uV6SE9uV6SF3u`1u$Kk-u,u1PP%u#u1PPuX  vP T0 ST utl6,P0Cl6mt6,P0Ct6f|6,P0C|6t6P0C6X6,P0C61 -LMP 0 `PF Hp G G/ 0p0 0 00SR#0M,csP0hl6H,YsP0pt6\>,OsP0x|644P &rP +"`(K0ԁܑ0 0 P$h61l6 1p6hlD1t6H1x6L1|6P16ptx|161\,Z0P0 Z, P@etW0 S* Р bs0P  0 Tt0`0 80 K0 3P 3 0S 0K00K00 0 00  0@0S 0 S S0P\S  @ D)F0 6 j+ 1 H6 K,dP(K 0@o@ @ 媢@  KKQp& 0 Q Q0 0A?oQ20#Q0;Q0S@ Q0 0 R \R0 "R! #RQYؐ s0 S00"S P0 `0)hKP 0S0(# P<P- 0S! @0  0@0S 0 S S0P\S  @ G 0 G@\ `LPl @s`\@TtP@\@ P0S P P0 S P P@M@ LS0 0"S ( P @ X>0K00K00 0 020PZ GG0Q3#//Q :/// 0-PL s@P0 s -` 0PR!0p0 L@1 P`P T(  G$Kk0 00T:T( G$Kk -LT\l0l lT0S`0T  DDP `@@0P0Q3#8 8 8 8 p-LDM`Pl@ 0XK 0  <K XK <K<KXKp 0R AsKp(/ 0-$PL@p$K0h 8 0-L@P 0 -LMhq@Q0P00 T1T!P`K< z8lK <  jTt0Q  P 0 0 0 0R& r P Z  0 t Z  lRh0@0 \HRD0@0 <(K(/9 l 8 9 9 79 V9 k9 9 9 9 0-@PL$0$ $$.pK0h;: t E8 P0-Lh0h hh PG@P p ao@P h0;:  V8 P-L[$0$ $Q0  T9  8 8 m 0-@PL,0, ,,PP 08  y8 P-L808 88T0S Khq Khx9  8 -PQL`P0 U0t  @T Vp 0S 90S@;:  8 9  0-LP@P0 T0K0hP/ 00-L0@#T @0 T0-SL0 W Kh9  8 -@QLpPT2T"TTDT0 R" 080 C0 2UU*PPt t0 t0 x x0R`9@0#P P @T T0R88P `)|0 |0T T0RPt06 t03 88Px x0R` p,0S >p0S 3p0S l(@V `P`@9  8 9 9 : : : -`PL PpP@T T0pS@ -L(M0p ` Q0 |T0S0  @T0x r Pp@PP 0X @KU@K 0R pK(/9  8 9 /: G: -P`L4M\KLK<K <KA00#V1 V< \K]@PTx  \KU0SS90SSLKuPT0pmpP| H 0|0  <KP" @\K,P\Kp<Km(K\K <T T0R88PY0Sx x0R;\K6LKT 00 /XXmP <K P T T0R88\P `P pp @LT0 04 8 <0#80_:  j: :  P-L808 88Q00   00 Kh_:  j: :  0-@PLQ0R ; -0-L M P ep@@K0Cp R-LP`@B4p p0S; -LM9 @0 TPp 0 I@P@9%P̐GY p0Sr,BP` `x4Pp(p p Xp  Dp 0#0Q 0F?oZ20SV w3p 0h1SPwp@P` $0P6S# xP h`P X`P H`P 8{`P (v`P q```\ 0pr D0S& S& #pe @ p_ H pY $ pS [x pJ dRp0l00B SpQpx +Pp1 080 C05% p" 510 R%P S%P0l0p080 C 0 xp p0S p Xp H0S l0$0I0KYp Kp 0F?oZ20S0F?oY20S x0S |   dUp l R  0 Qp0  0 p00sP P P P[p Vt0F?oZ20S 0S FoYQ V@P pVL2Pp0S0pr 40)pMj#pLdW%PpW%PI pCT0Sn   pI 08!p^@0S    p5 08!p- Vn@hV0Se h1Sb RP^ t0 0p0LTTpP 1 RRp`0PU0SS x1x!  RU RL1D!H`0V CP ` 0pPEU D 00 0R kQ 0(K(/ ,; @; N; V; c; IO <1; 9; $ $ F; $ $ m; AbzVyt; ; ; ; ; ; ; 4< ; ;  '< 9< D<  ; ; ; ; < < <  N< b< 0-LP@}p 00K0h D0-sL`@s!S ! !p0P`S  R H R pP41P pP?P ?P l pP0S h1S  RP 0h!pP$ F; 1; 9; -L\M0t0 0`8 1pSPP  p@H< K ( !R3 @ 0l h@ TK`p@ p" 0TK61聟pd@ `@ \@ X@ T#:dKTK7TK9 l0K l0`T0KpK4Y@TK~T @l \h0@HaXqt0 T=s[10C>S00@"$K!@03@0p@t T tKp0S 0t0 t0#40 l x SP l@j 0Hh0 0 p0t0 @ <   }< < < P-L? 0S< P@0`0S5 S P Q \ @ P.S0.S50_S-SPP,  00  ?R!"0T00000|& 00- L@P P0T0000Q   D00`@-`0 @CT`@ pT00 P0S@XROX0X x& -h1LS@PiPPE @ 0.PC_oSRPUdP TP @P ,0 .1PP,= 0-@PL'U_ 0 tM0 dM0 TM0  DM08,0)(& #  @      M0  M0  M0 M0 |M K0hC AP7= 4 %N>= E= K= S= Z= b= i= t= = P= = = = M= = = -(6ƒ \ 1 Q0^  ,0\  ,0 -QMLM`RNK0p 0 Pxp0 0 0L 0R /h.K 2.K l d0L0SPE@D p 0S@K(/' = E. = -L,MP80 ) 4h`4 Q4K<@PIg(K0S  xP@ r PpP@80W Pp W2-g}00 Pp,P R P 0 K 0 0 ?0 R RQ 0S 0fO0 _P 0 K 0 0 >0 R R p,P 1$03 C< BR 001q1 = P@-0S- Q0@ @^ .^^QRQ D B R @ Q@ 0D0CR000 -`p@LM4 < 8 0 VZ:W 40W00G<0S00T@D @BV00(KRY"0T?,SP0ZP8 `YPU`!` V?U0W 0 R70 @0 2.0 000p C0B00 @0 V:D X0 0 4 @WR  GS` -P`LM0p!0Y* @ U W]700(K$@PpG`  I00U W 00  P     \Do   ( T/T%8 4 00 8K\TU W@@U W\$0@00@@pGP`U W @pGP` |& -SMLMPd@0P P 00 ppTe A SnK `F.Dp8P%Kp T=p C KpWD    CK0 t@p P7 CK@Bp C.K B0x   T50 0R e   K  CKp 0@ V @P0P@T*p0S4 p @pT* T 0 >Kp @ p    F0V$#$("( F!Kpq @   F0Vp$#$(B(   FD5@!c#!$c$"(D% KpQ @@  FD%0b"!4b$#  F@{f   C.K.0 B)(P- C.K BhJp& 0S @00S HJp00(K(/<}b -LMP` @0Tp(0  ( 0R! eR R 00H0S0K -00Kl0#0I0K$00KW0$ 0  I$K(/= = -L4M@` 0L SH P (0S `0 Lp0"(K 0  0K   p000 00SpC\ 0KT6p 0"000cP U0 0!000  ;`0 0L2p0t!00|V PE,p 0S(0SU$ (0S40K0P<0K8 K@KH > ; #> O> y> -@P,p`L@ 0d S @,p$`(0d S𨝘@@ -LMpK TP0: S 00 KDKT00T ``P  \Rp`c0S 00S04!00/ -L PΠ RU00\L  ^ -LMp@PK0`! (0  K KP  KlSPPV@[ T700@ K᳿( 0R kc K(/i 0Q0-L@D0D DD߿ 圿0S00S0 00S000@G x LG -LMaPQ0@(0 00@ 0S S6 SPP@ ( 0RI )c벀X7pW 0 8K?$0Kp8KlGX@pWl0P@ 0=0S )ⰌP @T0S 00S   :K63[#!Q l(P@/0 K(/ -L(M` @Pv00K0S   hV0w'@0Kx Bp 0@t0H 0 8B0S00 0 <0S#0S|0@0|0 0  ,X,00Qx0 lCTT0S0SdlTT0S!00 8 00<@! 0-LM K"0K0 p K// p-L$M` 0@,K 0 匾#_PP 0R' @b !P 3"p 0K # ` @ QpLL 0 0",0KQpKp(/  {G 0p/P 0-L@Md@0TK0 PLP 4KP P 0R aK0(/ 0-L0MPt@( 0@K0 9 @Ks0@ KDQp (0  0R aK0(/8i( 00-I @ Lp0ll0l0@0I00 p-L4M`P@( 0HK 0  HK:H KhQp 0 ,00S p 0R aKp(/8i( -LM@|P`K0  0  0 pK K`  K0Q 0P [R aaK(/:i -SML M`3PQ @0 `5 H3H#HHϽT0S<3,# X(3#$ R~K pG#0*5K08005 t0 $5 0)EK 5 @T0$%@0$5 50 5  P T0X00 50 5 xP 5 0 5 T$5x 0$5 $5Z<0$5 |0$5;$5 R 50 0 5 04 $5UnK 5 `F0  5 T@D100@0 =xT@@D 5@@x @ Z; 0@0 5  YI @ 50@0 5  XP UPPEPP@ D ("(Op`50 0`R ` K @-G5[ST0 K@H[K AɼYI @(K(/9  7LG 9 /: 9 -LMtQ@0 00 00 "00 0`0 p@@0K K@ @ p@0 0R> Q`P@ ']P @@0K K@p@@_ KXPlPx Kl dZ 0@ T*00Y00i_ @T@(K(/ p-LLM@P`0@ `K 0 [ `K┻!> VL 5K3K,  R4K< 080V` K,P 0R _Kp(/ii@ -LM@`P0 (0 0Kp& K`KH00xKPK⼙K!\K 0X40 $0崖K00 40 K0O( 0R _$K(/kii p-LKM`@P0.QK 0  QK'0KK31KMK0Q/K0,O 0p4R {_Kp(/Ii -LJM@Q.0QK 0  QK0KK31KH00MK0Q/K00uOp (!O+O?Ka $  P ``F$` 0 0 bP B$  @V 0R -_K(/ji -_MLMR~K0 pGP%00 Mp_ P@\P R 0@0R*5[S)5[S= S:SSwR5S[K ApQ@V@T@4S8 :0CSR E@ @l`P K_>K B A p 0S NS0 8MR1S S  @0 0R ^Rlb0P Q Q 0$%C5[SH%)5[ S0S@%[>K"# 0C  %5S@%@)[Pk [K% AtfSd S05 5S  R0 085 5S  R0 08[~K pG@  `5  !>15 5 pNp30S 01S ))5[S5)[ 0^>K 0C0C0^>K 0C 0C0_>K 0C00 _t)5[Sq[K 0 @F[>K[ 0C  5[ [b)5[S^}K pG5 J0 ep0 01S )5[SB0)%[R= %[R%[ R  )[ 6  ` 6 p 0  &&(K(/i@ G G p-LGM,|@P0` 0 l0JK0K!#  .K ^P>K, lB 0R ]Kp(/ 3 p-LTM@PH 0hK 0  0hK`2h KMp 0R ]x0h KX0 |0\<0Kt0H0 p0P0 Mp$0S0h KX0 MKp(/liHmiH -LpG -L 0PG Q -L 0PG : -L ML0K00 0K# K ݩp  K / -LM@pQH 0(0 0p0eK` eK⺸e/K4?Mp 0p!8  0(0*000R e/Kp1 (Mp080 C0 .SKP SK⊸S/KMp0VS dS/K\Mp0VS <( 0R \$K(/liHG WiHH Pi *H Oi xPV4YP0 X TYP`0 4(Ko6W(/ZI  @_I qI I I -L M@pP`Q`,Q0,P !,ERP㤀U`,@(K<,P  R ,00 < 00`,P ,<P I I -RL Mp200P`U:]p U @ YPQ00V *"0 Gp(K0U00  0 0K⁉@0X 0 H<p  0K⓳0tX  <pP9 -AMLM aR0p(0 ݺ00@TPB T@ κ00BK0  @p( 0R WB.K B|p CKN0/X <p  p PU K(/< -LM 81SQ S  0K0 0{P K0S K1[#  -L4M0H SP@ x@@ `0D0 0@0 _0? @0o0 <0K0D 0JpP4;@0T0 @@0P0<0K00D 7`P <0 p8 4 W$P  0KDz8K4K0K8HP`@<0K0D y0pP3 P0 <0S0L0 @K Z00pq0L 0R*"0P 0W80 4p  0 8Ke j 4  0K{008 pS  S S000 040 408Ks0 t0[4KX0K8U H:P@L0S@0h` F0 0x0P   FF(K<0K0D !0pPQ <@LXK 8K, 0K(00pS yP@008S  S S000 040 408Kst 4K0K8 HP@8P4 1S 2S0 0(0'4 0I I -LMP4@000 0pT2 40K0`0 AIKpIKX; X8l0S,0S,00嚘 1S,08h0嚘 8l6S,00嚘 !RT28X2 X2h 1 S0㸣P2 X2P"l6S H lV 0pd30 0R 9U0 0K0p Dv 0$p 0 0 K0sp D2H >V 0pD 2V 0pD@ %V 0x}pI2[t0,0Ll0K?K 8kpfI2[e@0"0,0K ?K YpWW^e0T"!P !X,l ,aS  R/K  QP 0P2 <2 010 00}S<2S Kڰ88 *P <20C<2 00  00T"!P !/K  P <2 0 0 P2,0P2 (K(/I I J I %J =J @LJ 0-@LTP0hq 0 ah0h0l00l0pq 0 RpB0p0 0%0 -LM`@p 0尀SP$H` wS000 0 0 `00`00 6,#K0 ` $0UP 0,000 4H0#0x H(KoW#K0,0 $U 0003@0S3H000s8040$T S l000800S f H3i׷840S$0f $3iͷ4t0S) $0P%x0"T00 PS:f 2i봷 8s8 S0f 2i륷 4xd$T00 PDH0S0Sl x i 0R<0S 0S22H000s8040 14 0P0i18 0P0a10 0P0Y804 00@0S,0y Li/<Ap`%(p0s 0S*  0R% $1s tpp(Ko70S00 AAx0t (Ko(K^J }J ,; J J J J J ??kK J *K R K XK K  K K  -@LTPp \0 $Kk08،0 0,0 \ 0y0BD0S0S <0S $S  n! #`0 `Q ``Q000` 0`HpDQ0`8 `$`UCLK -LYMd?@0h 00 0Pl1 0Rt1 D0S`X,t0 ? /0Sh P  Rl1`00p1 p%p 4p1h` F0KH=PPP t0S h! BRh!R ( Q  R 8.Qx 0 000(0S0 S= ) [h1SS F 00 0S\00` F0p18|1 pp-0H/h!X= 08!L1 R J R1 Z= 8  "8!1  $ RR DQOh1S St0S x0R, 0JS62000$ 01 < Q-  JR&6 1 0 <h1 S"<0S 0JS60 0 <ݭh1h!0RSx 0JS90 00H( YKఀŭ|1?3S 0 JSM |!p?#\0 ᱭ|!? |1 2S 0 JS< | "0 ᝭|!  |1A5S J0R:^ |!pA%0 ᆭ|!A h1S |10S 0JS30p0|1p,K ! lp!KKp1p( 2 JS P |! |!0SQ0W0 0 2` 0000W00 `p1x@4S 0 JSi+ p @$0A @/@d``6S 0JSV|00[ ,K !vp1 p6JX:0JS>70000, S:`p1xh6,0lV*l10 , 0AR&lWoK%l10x%R օ T  0YD0QT SX,0 7 W @ 00 ShR PUj` pNc \7}g 0Bfl1 `00 P-p =뗏\L SK  @> CP 0D0 @QD  R0 60D1 _K _?K SR0|1|!8#<$0Ł ő"00 "9 `" i0S` 0   X`Q0p00S YOe0  A000 0# %(`p, paap P` hP:LP YM 0,,S\ Q:(,p P  hQ:@Q Y& `,000I0C0 0  0C 0CK/ pWwt1S @t1W/K30 0R O Kl1x`` pv  uM`PF \ll1t0S l1 $ P l1$Z <X x @3,1 K?KL1 0H1 Y?KD1 0( $a a p 0rh =h1s-  p0x 0'xl2 08#<48#8 10 E00J@0p08#<tp P00l0+h#pNNw 뙲020CS 3'0#0h0 0t1 h1S/ h1S:0#0 p10 0JS: 0P    F 0 0JS,20 0  F 0 0JSt0000I0I(/ K L OL cSc5?A6e5wɚ;eAL ]L ʚ;L L L CL DCL L kL h1S h1S 0JS80 0 H庪(K  p-L M`@0P`0 X\6S |0@0,`، 0 ` qO 8  Kpk 4 00  hL K b M 0-@ LP40#00K0h8M  8 H 0-PLU@000CS00L >$*O  000t 0%K0hXqM  m -P `L@t800  B`00P 00 <00%08 culKhM M H @ 0-P`L0@ M0h 0R0; P9 (k0#0H$Kk-p` $ P"0# 0 $Kk|  P $   .  Pd0d ddt  P0 $$KkM M N H @ H -L MP0 @ $(^, ^ $^9 4 8 (l \N  %y#=0 0@ R  P  p0 nN0 whh`H 000l (K,00@ 0)N $  -L0Mp@#h050 PK 0S 0 (0!hP 0! 0Q00 @K,0< K040@K080K K0 cDM  w}=N 00-8 PR@L  . P   8[0HK0h#BP0K0hM M -LSMT尀0@00 8`h1 F 0l P#0 $1se $1s00S JPU XJP 0Ph0p00P 06yH00% 0 %0㰐xЀH,0 1<8K 8! Z:  IP8v p، 0 0'0^ 8 K0s  PJ;0 %fK؀Fp0 ppZ XQp$ 0\%YK H 00 Y?K 0+0 0hHP8+ 81 8 08h d= HP8 ( 81) 8= =Q K0)  PL Dl10 0R K 0  8 0 E 0S 0,K01! % 3\ F 0 P lnh1,000s WKyp;P0 QP pG?K0 X0\0  J0 00$0H408L0CH04080 SPU 0S 0` 00hp؀G%0 DQ X0'0,0 $RL  {,0q 0Sn 0 Sh$BL   0< G؀G0 @Q 1@0, F0,0@\1P 0\  F`t0 :J0 00 R- $`00@00S( `pP `GP@  0tp0x00x0 `0 S2 J0 00 0S^@(K(/L WN $ eN {N X N cScN 2& N N  -L,M0@S`p P `0P 0 (K= R)*tP 0S 0 <0 48D S4"48#8YT:QP0YM: 4"48#8SE 0C \ R  Y 3R:0($lB>D0C$$ D44040P!/Y, 0B.D0B-K B0 ;K,0C,$ -K B(C=K 0C0-K# B! Y :K,0C0H  s@Tk0 0R yGTAND0T$#$( ;K"( B,0C00C B!(K(/$}r P P -ML,M`QJK0$@D(0 ;K$0C0C(`8 ;`Dp  @\8埪0@8 ;K$0C<0CX80T8=K$0C 0CP80L8 ;K$0CW,0CH80-Kp=K$0C0C B0=K0C$ D6p =K0C\ XxPHP\( 0R G R 4峾h0s0 K(/ P  -PL`jp 0|l0@T0S R `0S= R)pP  { 0 .@P -0L8l 0@  $Kk蓾t婾0 PTy6080 C0 D0S𫝸$Kk*Q =Q $ -\ Q pLn0 t\ \0.000 0S /$ -PLfDP@ 0y`h0 0<0S 0< S `08 HKh. }TQ 0-@LPT EE E8EE@l0S 0R $q <$40$1(sE0(100S 0S0 -LM@PX,08 P 0Sz =(\0؀C  \pgpLaC(Q QCp$aC؀C`t  Cl0 30F$KK{#KP`,  0UQ4 0 $Kh,P t`pX h0\ 0[ 0H Q@80 P ʚ;ɚ;6eeAYQ  0-@PL00 U0x0S0K0h -LM@`PU Q Pt0S  0 +0t0(KP0<Q+ R( 04 8 <PoF  4080 C 00#0 㰀80 C ' i㰀80 C #K0 0 S [ P`02p 0K<0 L <0 1#K#K0 0 0SMD0 00S $0 pW ! 03  0 00 0Q C @Rz 00ppWX0H0HX, 0` 0060t`<0}Q $ Q }J 00`( "4 M`4#S Ѝ/0  @R-0LPC00@`a`F@@@@  PePU\ePP/<0`( "4`3Z1S P///P/P/Q 0 4 8 <\R/0 4 8 < \/-P000P b8"#4b4# 0S 0-Pl0L@T0 P0@l0 R/0S 0 4 8 < 0# /PP/x0St//0o\  R/oS"P / R P/Pxx00 SR P/0 8RS/S/Co//cSc -LlM`t5t 0 0 l @T. 0S PU$ P  |K≝ _PP@0Sx0S t0S4$ |Kot0 0S! 'pP00 0R C|0t 0|00 ,K0T0(t0 00 090|K P^  pW:$0 00 pP 0,KT0(t8}tXy|K^Hp |KP |K|0t 0|0XxpacX" 8PyP X ||K/ ⾝p|K9pt0S aP 8p\P   A Uc  P < 0$Q  " Q  ኝP0 x (K5 LlK<   固XpP1 t0<0t00,KT0(080 txQY X TP }|KU |KCpP |KlY $Ȍ L(K 0 x (K5 LlK< `  4E033u(K(/ R !R vR NR -P L Ap`01S 0S 0S 0S  0 @T 0Q0 PSP 0tAU t0S0x0t0@R }0-t R 08l  P@ 0S / 0-@LTP>P@$й000 000 -L MpP`P 幹@(K080 C0^ O@P00 4>@P p 0000  0 48 B $( !0 E& $0$(0 ppB0 'jp0S W00@ @ P  0@4 8 < R 00000@@} 9 - R R -LM@PTH 0S080 Czj W V x0S eHKhKh[$`  P (0Q,0Q 彸 `P Kh80( 0000,0P0S K 0x tt0S  $0R 0x0t`0SHmKhR S 0S/0S/   -LM` 0R00 0 40 l R_00(KP pPS0  6V@ VP  0$(, 0R0 S   0LP34f=@Ph(Kok œ  ⾜    @@  Ⳝ $( A $( 0 %  $(, RX  ≜000000 04 8 <0Cs4 @Vw(Ko? 9 -LM0PS@ (K`lA000 0@0 @0 @@T 0p P0-L0@T0PL?K0hH?0 S   0@? -MLM`a@0X 0 圥P40S ,!,,廷41?S@<P@0041寷 0R4 ?0Q@pKtBK$  APW^%PP .p ;B.K40x 6%p ]pW4P8 88~U \/041K(/"S }j -LM KK Kh -#ML M8 0xR8 0 8 2 0( 00 00T20 0R ^?8 0C0PPB 0Q@0@1@S@@ T8 v >K08 0 8 08 (Q00.K8 08 B008 ; KRq n j8S  c _ [K @}K K @v~KK A @y~ J8@e D8@S-8t 0 n`pj QP0#03 WV00Sp^p`dZYX0#03YX00S 000w70jj(K(/! ! ! -L M@\0Kc K -LM `P@pE!@ R0p'ppW KP#s00/!(`P@ V0嘳L \00-@ L@@P\  ` dUU000S DK0hU0, \   H HR 0)N 1; 8S 0- U0 S   0 HP  0R 008!6`0 &Z  Rp ,0Kc 4 R@0 *@0 0X000U@U (K -LMp`0 0 l0PU@ 0R' :0S@P0Kp H00#0  L00#,   P00#(  T00#$  @TK(/ -LDMq`0 P00 PX`7@P 0`B`\`\ X0X93 ?o2"2  0 Hp8妱9@   0 0R, 9   .0 ` KP 0 0.0`SH``PKwp  0 0 S .0` KH(K(/@! 9 0-PL@ P0`0 p0uT P/0$ S/\X0H -PLX0`S0S0S@T2 NP  0RX0' 0 <P@ @0@  \0;0\00 0$0800OT@ @21; -@PL`PU RVhV <1SKh(0S 0<8980 `Kh 0-@L<*80K0h&8 -L Mp`P@H040 T? H0 400 ibP \0H0S`0@W W\0 `0 僰\00\0\0 0 S   0X \0@ 0 0\00PSP 3/\0@0\0V(KT -LM1@ T0 0 Q  bPpK7l l  K⤔`K K(PKK Kᕔ(0 0(0 aP  aP2S aP0l0`V$ 0K p0S 0S X K b00 0R 8 P0 aP 0 f(K(/M! U! ]! 0-@L ((aP zK0h;M! 00-PL5P@D̯0 0 00S hP a! -LMp`8 R0 lP P PUPP @4 TW (K HVaPX @08  @(p08$0(0 0000@@000 X0\009\0H0S0I R S: SH0S5I00S1X0.Y+ 0 S   0 03/ 6#0 3/#0 X0\0@0\0##W W0 S   0# : Y W 0S 0S 80 C 0v #0q4000Ph (KoK -PLU`pP@T3P H0S 0S @ 0`@0 o! -L$Mh$0P00  P08l0 Dq 0#0 (0S=@0D nV0)` n`P  h`P ^00`0 0R 6pWpP l2@ @0 @K 0< 8 4 @P` 0D 80 C0$` `H  D0K 0 0=pD0`0/5  ᾒ(0S= R)0P0*0Q0+0S`R00T0,0U0-0V0.0W0P00#P0 5R)P✒5V00`V  .0` )0`0@@" H _P!X0 080 C0D00D0 5ϙ10o` du5ř000S`b` P  (K(/! ! T -LDM@rPPK0@K00 0` `H00dp ! !0Sp( ( _PP  P ]  _pPy00a XK ,TK X08  H00H0 4 T0 D00D0 0l0pW1`1  0X0D180`0(S80 50@$0P$$0 7 0S 0 $0S S".0040S 0SpH h0 #_Ph0Xp00d00 0R h50000(K(/M! W -LM@` <$K%$K@P $KK)T ! 0-LM\0@  00S0\ !K0$K$$KPP00$U 8}T ! -LMP0Ā00@ 000 T @(K\p  $`V  0^PZ 80`F80`V00@p\p\00\0$0S$0 #`p cKbz ?cKV0 08` 0B880 $0SY#$`p cKbM ?aR0cKV0$08 @$ -P00`@LT\00 S@0S/0S/Q\    \ -LM0PS@ (K0`00 l$00H@ 0@0 @T \0p -p`l0|@LT<1h@T! lpN l0SP @\00 8P TPU0SP @ 0S  #P |00|0<PUl0S P PP x0x0da 8^|00|0@! 0`( "4`#/ -@`0LP 0 0V 0 S <  0 HK0,@D00 0D08@`0D0D  D   DP  8KG?C0K P BA8`7p 0܀`(K.0 BPDYK AR 8KG?CK DBAOpP :=0 0R[ N/ 0S080 C 00 0P R\YKA 0S (K B 0S 00S KA 0  %P  P (K B  嶦8KG?C0<1@T,@P P 0W  XP @ pK. A 0 ` 0`8KF?C`` P(K0I/B0`0S``(K0J/B 0| )X0(KQ/B00lh00 $4"4(K8F/B#8 Sl00"0Q0S   0S@0|0 0 0 0 :pP0{ 0 00 ?t0 t0 0000x0 0ScK IA (KI/B PR(K-B08K>C0S 8K>C0SP P8KG?C0D!8KG?C0H P8K=C(K0I/B 0# l0S Pl 8KF?C0SOv# 00 (080 C0 h0 8KI?C0S8p0\  \ 0(K1M/B0 8K>C0!S15: 01ʃ , 8KG?C0D8KG?C0H0SQ 8KJ?C0廥8KF?C0S 8KF?C \ 0,8KJ?C090R R RP t"K,I I0(KK/B00(KN/B0`0d0h0l 0Č 0Ȍ 0̌8KK?C0S  `I0I0YS S0Y0S  8KO?C8K>C8KO?C0 S \`V_8KN?C0@ 0(80 C 00(KK/BK 0 A _`P 8K 0C0(KK/B0580(X000`8KK?C0` S6  H> P0 oᩒ(KN/B \00\08K>C0(K 08KO?C0.B $0\0R0 S} 0(K-B0(KK/B0 SK A VP `Se  P` 0@S]Y $0SX 8PS@ͤPPK8K>C0S <048 #0P -8KM?C0(KP8K>CM/B 00C(K.BN(KK/Bᇦ8KK?Cp0l唤Sx0 P x8K>C0S ( 04 8 <00PP0001=001 8KJ?C0 , "8KF?C0S 008KG?C0<1  @@8KI?C0S+ '<8KQ?C勻PP0 傡0 |@8KI?C0 S! pS ٣P#H0 匡8K0C LP0LY UP5 f+0`(KF/BP00P0S0 (PL'h8KF?C0S O+\080\0X0(K(/$" V 6" V V W *W E" JW kW 6W ,Y ,; 0uW W W W X >X UX nX  ^X X X SL X X Y VY fY Y -L M@p`,DQ0,PH!,ERP㐀U`,@(K,P  R ,00  00`,P ,PI -LM<1S0  KQ 0S00 0冠m 0-<1LS`pP@0S PU@T  P@ <1-SL`pP@@TPU |P@ -@LTP" `*@*0@<1P 0pS /@l0 R 8q -80810S 0<10S/ R R \XQ /0<1S 0S  R RQ l R /0<1S 0S  R R RQh   /@  -LTM2p0dK00 0<1@T 0 SRPUO0x" PKY0P Kd!pD20 0R *%4 P Kp &K P K p ,00Da0e H!R#P,08pf0e 08t6SP`LP`FPV 0h0 0h i V*000P\aU8@FPCP0 Ɍ3(pƒt& P `F^ 0,R0DH!0R ^0, 0h1 0000P K0 0;\ , ("(R  R ` P KⒼpp 0P(K(/Y Y Y Y Y g 0-0L<1`SPp@T 0R0 @ -@L<1S0 0`<10P  PR `0S080 C  Q PKhG9; -LM@0 080 C0A K 0#K^#KP`,  0UQ4 0 $Kh,P |X`p`< `0@ 0T? 0@  @00 Pʚ;ɚ;6eeAY Z 0`( "4`#/ 0 R 0SQ/`" -LM@Pp"d$h&hU00U00K  K/1[PEĠ#Č Ƞ,Ƞ\K2[SW @ PE -L MT`  U n0@0(K0K2[$#$("( 0PEU*Z"0#[4"48#8000L!PQ \ T@0, -LEM`hF0TP00  0@Q pT:| u0 0RU }(!0 @K)pp@p@Y! :N_K08#<4  0ᤄ0P@,K! ᙄ&0R v尠PE&p R  (",  や0 } 0W (",$ EE o K k(K(/KZ  -L,Mq0P00 1R xA @T0K4/P [_Ⱐᮋ00 0 0RJ (e[V $ RK8[D DH$HTEK[_@Ꮛ@VT01X0`[ R R 8%'@t000h PK} P0KF$`PD妟 000(K(/kZ X" Z Z " -LtM0 0R0 5P000 D000p0 X50 0pRO '00 0t0 0S B x |0 p0 $\\00`00 x0 C0Bx0 6[D#DHDHx'xTvK T T @T' 0 0|Tx0S hK❃F[x0$(XᶆKx 0S0 0:p |0R0S00 `@H`K 0 YY0H$Hd6FKSS0#0T K 0`Ku  tȞ `" R 0 PP0 W \\ XPQX T K 0dKO0 0X0 0\0͞0X0 \0 0 P 0Xt |0 n1~긦[Z\ RX0S{ t S # 3Q Rt 0pp j0K PXd  噞[6[ `BS IZ0 0壞`H`K 88 4Q4 @D00408  p PB@T0 @,1岩0 `KĂ0(0000@@08 480R\   \ S$0 S05 0S S0Z}p00t0?o2R03St0 s\00\0\090\0(K(/Z Z Z Z _[ [ :[ p -L$MR`p P(@Љ 0 0P@0 Ɖ@00000U0<KPh 8#8S F d20h0@Pl1S 0KEP #[R? 460000000  SVL xp0x0t0|0h0hp0l0lt0# 00 0c(0 080 C 0 0Г(KzGP%*?h1S5h1h1S5h1h1S4h1h1S4h10S 㬀4X Z 딀吀0Sp ?1 4*4J0Sp 31h$h44>\r p R 3 #P R ` H0 H03h1hK(P4AQX@|P0@00 CrS00C00 CrS00C0Y0 S0000Bs (\$30(0ݒ 0Bs30P0ђ r 20P0ƒV9 `娒娢V4 \ 0 H0   Q `  L $ \  $ 0˒H`Q`  M R    `R0 8 s . S Q$  ʔ噬L0( @p Ti/H pp86p@Thٲ偉R ᤔ0 បt p  \0  R @@ H3P\0@0\0\0@xǔ] ] ] Q,; ] ] ] ] ] ^ ??=^ 8`[^ F^ u^ ^ ^ K # ^ M ^ -L$MP@U`p `0S ◔(K0 S 0SS  0 tP 倔0L80 0,<0 ,0I@0 < P1SN Z| Z Z0S20KR OP #[R0Kx0 4< @R0 %M0PT020KS 3P #[R0Kx0u3< @R0 %10X\00 00ApG, 801 :01 (0"(P0@  =t, 801:01 (0"(P @ 0 <0,0<0 v00CS8hhhл0 PEYO0  0 00pX28090@ 0 P 0 00p0S  CRn1S S00 PݓU Dm0 0ߓ8086 0 ԓl0S *h/Ph廓 hxlp0S0S 0 RS  倓\  0` Xt _ <_ h_ DQ_ ` _ _ }` _ %` ?` ^` # ` ` -MLMHK0,@D00 0D08(`0\0DP ~ | x D   D  UK @ A`4 p 04pD.0 CXHR0 0R [U` K A J`P50 P0DP )Th0RdD0P    P   0 S xҒl0@T 0S `0S 0 @0S ` PP Q. l @TS ` 0p  ✒ R ` R PP Q @  D僒`0 q(K(/# ` # ` h_ a Oa a )0% 0-@LPP0 "U0K0h -LM@PU M1`vh&hC (K` =! p` K p// KlK`V(p R00t p9p> p (KlK`VpP0080 C0 '%ppZZt UP000#?PUt0S Y  0 QP Km p~0p0t0I x&I N -LM`@#P0 @1s&p@`(Ko0P#9 *` PQ QRX "R   ,,  Q (Ko " Q!) p0hp0008d00 W*: PRT0 Ѓ(   00,0 pHJ}0S F}0S 偑(Ko00`VW#P0S R  R R R R S0   ;P  u090000尀p00`vr, \P 0 (   P, 8 t p \P(Ko&D00@ 0A(K# # p# }a $  -@Lp0PS( 080 C0  R)E`P 0 `Kh7\0$9\0  4xGt p0| Sx0p t  xa a $ 0-@L ͐K0hb 0-@L0$  廐K0h긫z00(Kp,@0L@0 P!唗 R%p,@08x 唗 (|&Rp,@!唗 R 04Kvp0@C T Tz004SpPpMp 8Kr0D0 0DH0 3[D#DHH0$HTCK3[@$#$("8))PQ3KM@ (xv|&R QCoT㩒R Y@ (|&RLqP " W" D0 @00p04  0L.P,p D0KP0 Nr00 垭P0P  ,pQY 0D 0800 04 LD0H0@Cyb P -@LPP|0p`p0 0᫰p 0,S ` 婍hKhL($ }b 0-PPL@P 0tPFy 0000000 P0P0 :R R @\R @:RPI/|&@-0P:P@A ^0 \:R\0@S^@\ :R\:\0/ & @-@A0S :^|^  ^^ S \0L:\\ |\  -CMLM84 0L !SP H$ PV SFtEPUB 0P@4 <@ `Px 00j@@;<4 5PU P= pP 0 `R0 :R `0BK00p84H$CK @P x@4S 8 )P  PP ;<4 0H@4 H PP(K84S$0 080Cp pBK HD `D4S$BK+ A87@P@4S 8NT Fx@Bx@P )0P84 0@4 B>K 0C0BKD4 H 0 RY @EPY:RWPp\R R R <$@T:BT4 P@DT4 @4SP 8Mp <$ @`X; x:0P0fN , 0Q :Q00$ C B  RpG:R:   F JD$ <$D BQ#T4 <4 CP @D pG `FT4 s@4S 8,lw 00=P <$ @p`  DT4 [T4 [D4,@`HO `@4S 8DP$0A0<4T*FP`:L4`:RpfpW 0 @p0p84 PW 084 0 S@ 0#SS rP PI/ &K 0-LM  0K K 0-,@L P 10 00I/ -LM0xB,8 0pS 0S`,0P4P %$KK A ed0P P 0@P00 PP U ,( B,(R#000S  R  ,( RB^KPE0C R*K A 1d0PF PC @0 ! "# :P #P R R 0Q\S0 Q\R  :R0 0,8 S>K0CI R  0 A0S@Z\R  ,( B:R|R  I/|& 0-@PLAK0hL -L`= m@P@ dPuv 00@^S0S:S] p00@\Sp0S:SP 0C^ 0@0LT1 0L\TSp$ ES/ BS CSNS RS" FS 0fS cS eS bS0rS tS nS 0 R@AdP 00Pd @0:SS0AR0@A P Pd : -L`= pP@ d2PpGPd0u 00@0S @AdPPd0 :RRAS@A P 0-L@# P 00S 00XS@ 00B ^a0BSW0BA0BS70BQ<,00 00-8@L0P C00I/r -L M`pQʟ 偨PV00`c dP00CS0t/ Pp0 0 S,K*D u@W00S( jrP  u, uP 0KP000SW@0XP40S 047σ4 ,Q P04  S 4 ?@T Q P0 ` (KPI/L/щI/ T00- LR@ R 0YPiP 0I/P/ 0-L@HP08G0I/ 0-P@LPP0.P0I/ 0-LP.P H0@QP 9P87SU00I/P/ 0-@ LPS P@0 0 0-LPP H0 @RP P87SU00I/P/ -L MPUp``@oP@(K R 00C P 40 0 ~qP0 40T00ST!`@R ////// 00-8@L0P 0C0P/r -L MpP0 *PW00p bP100CS0. Pp0 0 S0,@K0$0 st`X00S  qPTtHtP 0KP000SX`Z``VwtP 0K⫱P000S htP btP0 \tP0 hVtP PPtP 8JtP${ :4BbPvp(KP/щk -L Md0 @R R AP;,@0@00DLP0D KP/0Q/ -L MPt0 `Rp@ @T 00P@0 'P`  KP/ 0-L@P08D0P/ 0-P@LPP0-P0P/ -LM@p`P XPQ@ 0@84ST@p$KP/ -, LM0K0B0;P K0Q/ -LM@p`P X PR@0@84ST@p$KP/ -, LM0K0B0;P K0Q/@    / 0-P88pL0@ ]0`0D'Q@-@S`P ^@ ^ p\, 0S'@0S^ p\ 0S0S0S@ R@@0@0S@\ 00SW@+ 0Sh0 P R  R 0  \0000 R ^P ^  @0 ^ 0S90^3P QR  Q0Q  S  0 0 0 S 0 R  R 0  \000^ 0 0 R   R  R 0  \0000 R PP P R R R  Q0Q  S  0 0 0 S 0 R  R 0  \00 0p@-PS  Pr0S R 0 p 0R5 3:p 0 @S5@T `V `@T@T@0@T@ @`S@00 0 P@T@ @T@0 @`R00 0 T `V @Q@T@0@T@ @`S@00 0 P@T@ @T@0 @`R00 @-@S`P ^@  ^p \, 0S'@0S ^p \ 0S 0S 0S@  R@@0 @0S @\ 0 0SW@+ 0Sh0P R   R 0 \00 00 R ^P ^ @ 0 ^ 0S90^3P QRQ 0 Q   S  0 0  0 S 0 R  R 0 \00 0^ 00 R  R  R 0 \00 00 R PP P R  R RQ 0 Q   S  0 0  0 S 0 R  R 0 \00 0@-0S000R 0 |@ 0S  R 0 \:rQ:Sn0 0 S5^ PUP^^ 0 ^  PS0 00@^  ^ 0 PR00 0 ^ PU Q^ 0 ^  PS0 00@^  ^ 0 PR00 @-@S`P ^@ ^ p\, 0S'@0S^ p\ 0S0S0S@ R@@0@0S@\ 00SW@+ 0Sh0 P R  R 0  \0000 R ^P ^  @0 ^ 0S90^3P QR  Q0Q  S  0 0 0 S 0 R  R 0  \000^ 0 0 R   R  R 0  \0000 R PP P R R R  Q0Q  S  0 0 0 S 0 R  R 0  \00 0@-0S000R 0 |@0S R 0 0Q53:S  0 S5^ PU P^^0^ PS00 0 @^ ^0 PR00 0 ^ PU Q^0^ PS00 0 @^ ^0 PR00 -LMp Hmj0`@H`FPPR0T +:0 00 z/ S9#4 80 00 JRj0 80J B P: S:4 \= \: `P@(K@@P` 4U/ p-LMQ0Sy A1` 6/`1!6/  ! Q10P! \`6/! Q 10P! \^`t 6/4K` 1!P6/4K`0 06/4K`~0 6/4K`u0 6/4K`l|0 6/4K `cX0 6/4KPZ40 5/ 0@ 4/Kp4U/$&9r $Zr zIVs.r fr K-6r 3r w0r r r r r r r `r r -L@`Pph h h h Kh00@-\ l /o@ b2%", 0 10 RP^ n /o@ b2%@ ". 0S0S R 0S  P0 R/-$0( 0 010LQ\   $ $00004U/ 0-`pPML00`< @PFp00KTT pPl@ \K|,0@) $0\ K 4/0 0S [$&r 4U/00,0S/ Q05: 04U/ -@L00Ps P$0$`p0 ``FV`0P0`4p8`pU <PPP P48P4U/ L0?4 0-8?@ QLP:4@4@0P 04U/ -L MAD0@`H0 0$PPM @0@ @$@p T:0 S,$Dp0pW R# $0HP L0 Q(K " 00 @00  4 C 00 00@4 J   0 @00 00P^(0( 5/ 0SL0P =Z4U/$&s -Pd@LPpL`1T00SPL0PL01SwPqhPP4U/0T0S P/4U/0XPI X /4U/ -L@M@AP\0`Sp)`0S& `0S S f`0P00P@0`$K +@㸐T*P 00 \@Zpk@ dKe{\0@T0d KP4/ 0S Y 0SP 0P0:4U/U/$&r -lq$@(P@`@6e2U 0冑0C001$  0LS  h0S *0s0`FP0Q00Ql0 R1 *!$q P P$  QP 0R 00 0S0`Ss 0S P J @ $KkC4U/- R 0(0# 0 4U/ -BMLMEppWpdj0,K@4 004 0,4 04(0 ppCKOSp00VI0@<00`o`U(Y Y +CK!p~ ,0K04@CnK`F0S}Y.j@400S $0 >Q 0 x1D(CA3^@0HC3< 000 2 3!l < !|C $2hhh 01C0 0@S 0 <4 84 44 P,P\0`dP XPRt0 0t0t0S3R05 0S#11:PPPPLp(K2]`P P 004K2`V~A C9R񟗏|(\pDx0 0=00 0800 030( 0 R0C+0)0S&0t00Ct0 t000000S0C0( 0 BR 0 0S0C 0( 0 BR00 000 00000000<4K0;4K0 :/E 3R00S?00< !h$L00S0p0974U/$&7s ~sHs 0Ws 0p0S/4U/ -LM4"@$P PP`r (0 @2#$`\P] BSpY  Zh0H@DD)X!@җ X-1(@X@< 2S051 0 0S0 U00 S " 1X0威t@  eSU QP$KQ0S  PYS  Z'h , <K0@,Y  Zh X0X@04U/c  -AL 0pS 00S PP900s$P`d0SPV P}X0X`0\0S`0S PP ``0`$GWPPP0 0`0U 0d`V`p U01`5:RTpV 0S:S*G9X0X`0 ``4U/U/ -L MpX`(1:P@TU% `V P v`P8 h0l 0B1P $1h@(A  R  !P!@Pl@  Q :00 @00 $~SJ(KT@1Q*P4U/ -bLx0Sg:0S 2@c@Oop d0㓂$$@PU' 0S$ 0  B SQ0 @0R`A:|p p@C7"} @p0D d@/oD@@@D PU Y  ^ 0 B P GP  @0U 0  b Q2!  0 PU@0dPCPPS``UT U@Q -LMQ@ \00 `VR` `p KЫ 0L0 x0d-00 KЫ`vpR 0 r0`0T `LM -LM0xhF K"SPK.XPKs  JZ1Y;Wc  J JV;TE[(KPK 0 J0S  Jx JX ` JL J< JY' $ J JWV  J JT  J ~J (KWVTZPKYPKWPKVPKTPK(Koh=0=@=<<<<x<x<H<P<<(<;< -PQ0LM0R0p@00,`K0&4娄080 40<0 40@0 40D0 `P 0S nSl a0CS񏐃ES~}|{zyxwv&srqo8 ]PY T000U000 ]P[Y T070U070p \PGY T000U0000 \P0Yn T080U080 \P%YT000U0000oS \PU000T000u0}` \P (K@ \P , \P  \P]YI T080U080K< \Pp @ \P D \PJY8 T000U0001U080T080(U000T000U070T070U000T000 (KU080T080U000T000 =\P t 6\P ~\ /\PxYRb:D;$;:;99X989888H8\866H6 -@PL0<`K`M>Spmc0  CQHLDX\ KK KQ P   R S) 0$0h0xh01CP/AD`h0 \@ + h y \ (K Y  @` 0S!0=S 0SX4Y :0 $Q]wT ʟ! \ \[ Tod SZ*h* !h $Q`\ (K B8:y0A T jPl\h0`PA0P'* C!R̂ \ H" Rd Uh0 \ R @[(Kh\gh `\ $ \@)`' (K0 00 H‘\gp5 h0\@(Q 0H2 Sjh d0R*\0g1@Xh `$\@ (K  QHAd1H QVP>lgpl( ,0 0( ,0$0S0 0##0 20 >0 *K R0"ό  0Šx $0SD"x$0S  " "x$00$0!D*K0 C^HL  Kh0 00 0 0000 %DdR| 0D&$D%"D$!D$ %XK|K 'K P D H@v. @ L?% ?#T X?$ KP?%*K&000\@t D0$L^%zhh #c D#^ !X D!R D !M!D% #H"DdRD K&*K%<D p*K!D&*K r0#- DS R5 S RQ, $h DD*K  Kh*Kc 0S " R >01"ό0 Kd 0 tS KP 0#!DD*K D%  Kh ##DD$!Dh% 0$%h 0S !p!D*K D%*K#$0S"x$0S"x(\ KU  RR $ RO D% #$' r0'00 $\ P"  0 x'x00 u(00(0q" 0"l,00,0h000d % D#_!D#R KD1#*K&S!D%!D#L0 K R04 KdP00(0i 0$0h06Qtp h %*K# 0&% K&!j$ #"d"$BB!!!!` 4 l'd 0 KR K#d 0Rd 0}R K%T 0xR_   K Q P RlQ P\  0$$%_lm 0$d K0MRd  K0HR$ -LM@ V02 V0X0 T^ 0gK2c ? }K pP# 0?K0`0@ v K_?K E# 4 @`H`X`D`L`\`a a |a xa ta pa PPt1Sp!RʄQ|!R00 1Sd/` `Vp!pFV0dV00`$`p0f1 kV#Q PK 004!R0 SR P`H@$ $" /KЀ80 FXp1<"R:1@"R60 YXx3 Q9Q2 @0>C 0C42 8 'PQ@x0S Ug0K 0J3xPQ@8|!R qW U20 (KD2 U rK YXD2 /K`"&`Pp!&/ SXrKK$ P: 1!v> 001K 0Q?Kvn@ `F 0a Q0R! 4"0!& R1 ŚU 0$ _0 QP`p J 00 QP U0S }U0SXxst Ϡl V 0H0}K2 pP 0 KgK }npꟆl3Q0rK1 vΆ, a`\AU KoK !rKp@PP  0 TP@P P$0P" 0 K ?K R]?KPA _ 0BTR"^C@T0S ]Pà̌?K@@ P 0 @M0 QPQ ꃏKT#00T0S@xT00 (K0rK1 xЀQ0a12c1XßD2 T D2R 2$2#?K 0RBT"^SC@T ]Pà̌0T0S 0-@L Lp0QNKT0y0at T00 R PQ R  /  ,x   0@- DQ 0P S@@H  ^ 0S  Q 0#0S00w` P H  Q j.0 0#  Q/wt00@-0PP X@o> 0" P0 0v -@LP`p @P@0%  P PP0 0iu0 0@u -L M`SpP% ؐ0  00 @`P@nN@  0 pP  `P PX M(KXP Pp(KW 2O 7pLu -`PLQp @Q P@D 0DB(000S  h|' -LMp@`P@( VS K  0P0S KS0"S" 0@000S0 4/K7S0"S1Es\0@T000S PK1Es$ !('tx& 0-@L K0h -L MP`U4  PP2S.pPD P@H BPP M \1000 `0 @P- 0nS: =sAP00PPQ! Q P 40R 0 IQ0 @Q0@P(Kt000S UpR(K0oS@GEp dtH$ -BML M`pPRD  cP:A@P  cPn084 8NP @c8*`B>K 0C`CK@4  0@@ Q;p 00P<4 p @@ 0<$C;p \<n`P) H3H 0K 0 :pR  ;@Q IM 0KK #  K  0:P K -L?M 0KK #  K  :P K 0-0LM K"0KTP K4(0 P000  00 /Trh8r 0-LPHU@ P?( $ 0P 5/0q 0-LP:U@ P?( $ 0P 5/0qt 0-LP@P0003/03@5 2 T *`L0  J <  L0@@ T p<3p2 7X` ( V 80<S  Y>0305p20 0R 0(K8@<^P0 0 4  T4 85`%5`5p2 VP;0X, D Q)R00 L @D04Ppp S>03@05 2 T *080 J < H80 W@ 0"  p0< `8 g@ T`502`P Vp0,8 X` VPT`P VP@ T !`5 102;0<0 ;0<0  &K ` < 0 @T X \ 4 8 0 QP k * A<RdD  l2,! L0,   S3"QJ 4 RX 4p 0C@D0T0 0\PP S>034 5@050240 5 T * 40J < 4 004@@ Tp0< 3p2 7T R4 \P, 4 t   ` S3" >L b@` L` lL L` L8@`L B@ 8̠@H b1̎D` @ ܄KPKK`I 4 RX 4p 0C@D0T0 0\PP S>034 5@050240 5 T * 40J < 4 ,004@@ Tp0< 3p2 7T RW P FRs ` 4 ` `R  P0\ 0 l \c P\0 ` 8@<Q  RX  X \  \ 4   T4 8 5% 550p2P FR PB0 p04PX` W- S+UX  B@D T  P\` R> 3@ 5P2 T *00 00J < P00T @R  0< p`0 40 0 P 08 @ T5 2=QF  BP  Tp400 `PV Y+ P R(XX A@D \Pp R> 3@ 52 T *00 00J < v00W@  ` < 8 Tp 00 p4 d@ T`52 p8@<Q  R\ PX  X 4   T54 0p2  B8  04P0 p`V W/ 8 R,UX  A @DT  P R> 3@ 5P2 T *00 00J < P00T @R E < P8 \P p 00 P4 @ T`52 P0 J&K  P@ T # 3P00` %P!p0P1` 50@ T!`512 T , 08 XP0 ` @ T *TP+@ T*`TP00 0 Tp 4 p` 0 4P Rp0 @ TP=03p20G5&KJ < P@`   T0p0Q # 2R` T , P8  BR4 RX 4p 0C@D0T0 0\`T  S>034 5@050240 5 T * 40J < 4 xT00 S40@p 0`0 40 0< P8 f4P pP0, \P 0 PT` 8 Y R6  BR34 RX 4p 0C@D0T0 0\ S>034 5@050240 5 T * 40J < 4 8T0 40Q@p@ T0*= 4 pTPTPh@ T #0T %x*= pT r`0  BR-4 RX 00C@D0T0 04p \PP S>034 5@050240 5 T * 40J < 4 T00 S40@p) 0`0 40 0< 8 @ T0 #9*# , ` pPT 8 @00 TP *=0T p4 0G`4 T040 @ T# 3, 500T 0%5p2` 8 4 < 8 004 T 4  `4 0 00-LM@0@K0 p-`PL M@ 0 y 4/Kp -LMpRP@\  U`PC/8Pa` T1 0(0p0. (K0S% 1 0 P0 p0)+8000,:P0H| 0-404 00L0 @>P80@0800< 0-L@>P80@0800 -LM0    K -LM0    K -@?LmM0PQp1 p `  P?p!K͌Z P}t?p!QKK͌T Pq0?p!KF͌(X Pd>p!GKF͌(W PW>p!KC͌ V PJX>p!KB͌80S P< >p!|Ǩ0S P=p!TKB͌l=@ 0St=0SDH0\͟ \@4 P$͟ \ D  Q̟ \ P̟ \  h QX̟ \ $ P̟| \   QT˟ \'( |  P780@1 T0 P0AlA  |1 0x1 d1t1 tx1PQ,0Yx!10 -! `q tP@ Z,000 V?j f`Xʈ`0ws!<11 P,0|!B 0 11 00p#=S1 @0C1 |1S+` 0C 1 A 帡 Q @Q0P nZ,0!0 0W?f  1`SA帡Q1S S `|,0封0pD,00xJ=p , H0 ?3p3 Z H0x1!0Sx1 b01 I@P@t0A 1 B P 0! 1 ;PPPL0Q 1 40P0`1 .P|!0B BR1 0T! 1 fʄ01 !t1 =a! 1 xA X @,0tQ0p0P` pW,00p0T? d@X Px1!0Sx1 !t10t1 xa V,0@0APDX,00x<pH , H0 ?3P3 V @0!|10C!1 R0Q1 ʁ01x1 1 !=a! 1  t X" @,0t!xQ0p0P` pW,0t!0p0T? d@X P1!0S1 !x10x1 ڀq嬁Wʈ!,0P1Q`AD,00xp<p , H0 ?3`3 W P0(5p 00R 1S$ ,00!`0Ap!!1P0X P(U,00`p0X?3 #h=01S!| Q(,0 A0` p t! @0Qp!!1P0, `V,00`p0Z?3#h=0R t1X!R& ,01-pp! 0Q@!!1P0 @T,0 0p@0X?3G #h=01S!|PQ,,0 t  A1@1x! p1 `0q!!1P0 X,0p!00U?3#d=0D x1@S ~,00` 0 ?33`00wsD,00x<;p(K#! x!10( TKQ;( [KL;{ ( QKG;( KB;( GK=;( K8;( K3;( |K.;hZp1 0KA a P@`pPP  U1AaPv R:Ka С A Q @P`PP   U aСAQD@!R! z.KЁ A Q @P`mPPq 1 U `AЁQ_`Z11112@Qc q P`pNOKAPPE U `qJ@1p 00Rd80000S`ꌡ11 1Pp!U000Kx @ `PP@ 0V  ` xx pR00t Ppp`KPP 0U  pt@0T0D0p `@PKP@ 0V  `p0Ppt!W00H0K|Q `P@P` 0V @|Q -L[MpC`[?K@p Pp x1 @3?K͌l1Q?Kl t1 2?SPK͌D1PDQ G_K2?c`F͌(1`a `K{`2?spF͌(0p0p pKn2 ?C͌ 0̀ 褀K`1?B͌80 ᤐ |KS t1?̌|0 0| TKF $1 @?BM@T0T `0t!xp(KQ?Kt1 j G_Kv `K 0pK 㤀K |K 0TK    p-LMLL `P @0`0P @Kp脣 p-LMLL `P @0`0P @KpT0T 0  D@Q 0Q(00?H/ἢ00 D0D @ 0 R ,  R$ 00?H/D00 - 0DD  0 L R  R! `?VH@PpqU,010 0RD   (  \@T 00ء000 00-L L0 H?3\0 ,,  \00DԠ00 -L M0XaSP`(KPx@P"T= @00 Rp @p0R0 T0 P X@0 @x0D0T pB@W`0 ?3Q HQ@   0?33H0P @xP000 00 00-SL@P ,P000 00p-H ?0 00S 0 0 Sx0D S   R 0S 00@000 00ꌝ P0-LP T@T0{0T0@T0 00 /Ě -L$MB2@0P`00 V| t2*lh2`\‚0T80 ‚@24 8r 0< (Ÿ  2 H0 0"$0 @ TpXppD \p H0p`pphp pip0pjp0zP吂8 4嘂<$h0 T@jXD\i`4 04  1 0 %0  00  W(K舠| x|p 8 pl4p d< \` @ P P0D H0D0 400(8$@ `(4 -prLMPPp T@P 0`  PZ3$20"Å"bbbdbhb``c ````cc`FPV ci pQ p|L 0p RS `b0``` &P: ```0 &P/ p+ !p' ``0 &P  %OEZ000S :3S V$K|$^\@$Kh0S 1Pj4` 0-@ZL$||:8(0( 00 R  K0h,< -L MPP10`PC+@/T->  | ! _|o#*:!Chd1W?Ch3:| R 0S 1qȌ0 S Q(KQ  10 S>t!?ph`pG( P4 U(0 (K>v<s^pvm8#j:g0'd#az #]H#Zp-W-T`_Q|NoKpHrEyBz?{<@|9h}6pH!,&+!%nvu#s#o4%%$%#d"e"DH -808 0@L_k( @a4T(PT -L$M0070ǟ 0 < 74 080 70L0 7J0H0 6}0`0 pD0 Q00S[  p #p PP] pTPIQ Ĕ0 s 00bR SP 4T P60 P0/N 0 ;0  TQPEPaU 0 ;0 4p@ w @0SV 4@ @ P0u0PPcRTT 4U P%5 0(Kp PP  4P 40 s 00bR$ 4$ 50P0/1P~Q  q lRQ $ 04 T0Q00S<0 S0 pk 0P@6 pb 0  $ `0Q0  40 n $4Rs8 R  P0u0PPcRT 00S<0D S{ 30!` p4 O0P@h p+ 0 $ 6P 0 r  ; `R $0 4p Pl pp 40 s 00bR44 $RJ0P"0 0(KS0P@-  $ `0R0A 04 04 0 s 00bRS44!0PR40 0 ;04pm4|S0P@c `000P D00 s 00bR A/o 4"x1x0!`:H00`0044 0040 s 00bR44QL 10! 0 )㣹4L 0 s 00bR4k00g  @0s444 00TP0u0PPcRTT@ xhX؋xlAX$QH؆ 0-P@00 0L P~9 T TT0  -LLM4 8P@$ 0P`V e :Ó\jQ A300S(K30h0 X 300S  8Z  'P P@ \0-L@w5P @q5P 3PP0QP 40P P000 mR R0@0R0 1BQ;R" S0S0mS0 C ;S R00S0 S0S0;S0C  Q0R0R0R0 S0̿ -LM0tSPp䔟 J|P M0m 0Kr(<`0"( pD|2S #R $ lQ+PK?T0 ᧡TDF+P ឡX R4$44 |0T`# 4XS0300SJ p0SG 4S 4S> 0t#W2l"Q匑T 5P[ p3l2Z; L1S80 7 `P3 800P, <0 8 4<018 R! 0p22Yt2!2Ux2  PK 2x2h(KL%R4S 4S0?o2 8p2l2Yt2 PJ H2t2 0D p$l h $ <%$]U Q4P1l2Y I4Pl2<l2Z @4Pl2?;~0l2Y 54P1x2Z -4Px2?;~0x2W #4Px278x2U  4P1t2Z  4Pt2?;~0t2Wz  4Pt278t2q|200S0X00 r(0"([C|2Se1S0% 4S!hH5S^,dԽ@$ Թ0 00{0 0$  T X| hp  ` lT pH t<  x|L{@$ 88 80 0Q $0X 0/0z  -L M\`pP@T 0S"!0S S0S0YT0(K 0  -LmP 0, S0 2 㲵Ȼ -LM@bdqPpQ$K p` QR  0 $K00$K PQ,0 ( P`( ,0 ,0 ( P( ,0 PEᰐ帐 少帑P Q8X(0(0 0$N|yH\ -L@PU1Pp p@Pp `E`PE0 0"@0V@0 t 2@  -`\LP@U 0S1 RU0S@"0@SKh -lLp`@S0 SpV0S"Q0S 0SV -LMP0 00`P@ @ jJBK0pPPPI0|" QU 0P - [X$Kvx\s - LML0L0 P  K 0   K4u \0 Q0-0L@D00S :T "0p00t -0 0`L0PS' :#CRQ# # po0@P: #Cs## B0:#!BQ##`t - LMH0H0 P 0K   Kts8 80 0Q $0T 0/0s$ -L`Pp@P 0@ ^40SP0`0:3S 8 80 0L 0:#r@ -LM||#  t3tS0l*`d3B0<0 X3P08 0 p 40 P%Wu 4p p P@q \p   0 @s 00lR00@0ϐ1PB PR RZ RW00d S 8 `2`0!`pt u @@X%pk t00 ?R 4` 0 S[   r  `R R  1 0 (K ! \D 0 ^(K:p P@0 ` (K@0s 00lRS  @0 S @@ ` 0 < 0 @Bos 00lR00k s008`0`0 0["@  0rxohooo$QmmH8Tl -DSD3P`L@P? 80$ R, ; ʌ3SX#3Sp 0C#3WQW " Rp 8L !0 00@ 000@#PQ 80@ {p0K0P @0 PES 0 $P(KDZP <0$C02@080)(K ``AK -ZsLW`@C @P03Q4 Q'W- Õ@ @@DP00  W#, BO@\  D@L| @W@3@TKh 0-@PLP T0:|"C02TP0:CT 000P 00 6 /d808 000S :3S /><0< 000S :3S  b/8>808 000S :3S /=<0< 000S :3S  B/=808 000S :3S q/X=@0@0 0\ ʌÜ\ 0  !/= 0-0 00L@T  J3$S |B0pQ 33K0h)P K0hk0<<0< 000S :3S   / <T T  P 00R0S*P4@//;000 000S :P /p; -H0H 00L0S :P p Kh(; 0-0 00LP J3$S 3S p K0h|B0tQ 2K0h{(0:-$$ 0  $:000 000S :P /9 -LM008 0p`V# ,@K [$P0wp AP 0 0p kp@ (K 08 @@9P  P 2/ -jLP R3S @P4P30@SKh} 0-@L J 0s3$ PSP"0P |2 $R 02S 0L3H |20"1#3003000p0P :3S// -8Q@PLP( ?0S&  0S  0S0$,"0|00 R   R   R  P %  4T `TT *2S Q P Q0 <7 T0-:|bL0PT!@RN   R@ +@   R@ *@   R@ *@   !R@ )@   !R@ )@   !R@ +@  R@  @  4!R@  @   R@  @ @ !R@ @ @  R@  @ &  (!R 1S ^  08!R 1S X00S T@ |'(@ Q0@0@!R@  @  T0-:|2Ha0`T1LSP@/  @0;@0 @0:@0 @0:@0 @09@0 @09@0 @0;@0@00@0@00@0 @0 0@0@@0@0@0@00@0@00@0  X00S L00001S@078@0  3t808 0 P @0?30Q@ 080/d2(0( 0 Q0/2(0( 0 Q0x/1\0\ X0 0 T@0ʌ|œ78@0\Q0@0/10 00810 00H1 0-P000 00L@ :00Q@0?30R@ 080/R/R/ -PSL` 0@H@?-$$ 0  /TD0ʌ|œ  \ @0R78@00@0/@/X 0-P@LM00 0000TP  Q R  R ! R! R! R (!R !R 8!R !R  R/L1S/$/t0 0000TP$  Q R  R ! R! R! R  R4!R R! R @R@!R(!R !R 8!R !R  R/L1S/`.t 0-L@ 00 0K0h8- 0-LP@ K0h -RL M@ 0P P S CKh y Kh 00 0 P, -LP@`#p Kh -L M@00 0  @ K+ -LM K -LM,, 00  Kd+ -L0@"`  (  P \ GoD  Q\<PH    BQ   Y(K0GS18&0 00 000 00   P 0S006 , W10 000(K00C?00(KT0`Xp`00pGW%ڬ` 0W00 0 p`8 0  000000000``00 -LP@`3 p0 00Kh -LM,, 00  K< -LM K\0\0T  0 8Q Q @0<@0/6S/t< <0 0001S 00 @0<@0/ltP0P 00008!R !R @0<@0/6S/t,0, 00001S@0<@0/t\0\ 00 T0:|20(Q Q @0<@0/6S/0 000@/T0:|20(!R !R @0<@0/6S/0 @ /D0D 0 P0  Q ARLP// 80-P L@`P! Qp LJfY C<00`V $00P40 00dQ 0S0BSLP //,0, 0000P//t,0, 0000P//t -L M#3 0@`V 300S`H0c`0QL zSP HR  H4 4 pAWQ ,  X    !?0pGWPEC R0 6q R*0 ?33Y0",0P D `Ĺ,  xPPp(KP R4 4   BR 00pGAQ0 4PU 00C )0PEUP  (KSaa BZ 0 0 PBU4P ,0   ^  0   !Y0 40R) Rp W,0几0D Q0 `O,0 0x0p0 ?## wp4000Q40 P00S`0 0CPVPpW 00P0/ 00Q /p@-@PpP`V0A(, ,1C Ba00V00@PpP 0S 0@//P 0S 0@///// /// -,0P!PL3@A,0p QH`@?cq``W2800D嬸xp0?330 @WD圸Z0?#R RwsL\ 0 @ 00C 40 00?oT 2 R0S P/(00!//-(,^0R0SQ!R@ -L,M<l |0^Q0P ,!0 8C8SP H0 P00S0x0  H0 PT P00|0 |0SP0,0t0 T0 @0 =0h0 P0@@0,0T@1X0 P1L \0 `00,01L00 x RL 00P `0Dw h0x p h @0Q?330H0 `0\0,0000,0\0`V0V 0Zp@Z1Ad P `\Pp,pLpP 0A @D08` ?388l p@0P0 H V8So00S4{  0 \ p000|PE p0SB 4S 8\  >l @P ` 0 Pp 00pS 0P 00P fp C 0p` 0 0 B0c 6 P080\00S0\P0@@ 0mp000P   U P! f;1l  0  8 Qp000P f't1l  0 8M RPlp U  1P 0 1Sl@pP6 V 0` 0 L5S( 0\ 00RPlpU 0P 0L pP0V0p L  `4S 80S00Q0So L5S3r p-LMP0P`@0 R    80t p  PZ80  H00  0 B 0C/? 0 0 Kpp0 00 -LM@ @ X\ `0dPPhlp`]\P  $K80 8000 0BPCp`op`$K0 0-@PL0@T0 -1!00L0PSHp0?sppS,, ` !`@aT:pDx4p0?330 @V DZ0?# R0 SC 0 00x P0-L0@8T0 p-L M@PP U 00T00S T PP @@KpU  Kp`00`@PT ㉠P @KpP/  -RL`p0,S@ PPP 0S @ pRQ A@0"2"#,"Q/  00C0/ ,0-00LS  -L$Ml9li0h)`@P @  p4P P8 3 0)0<0 ^ Q  pqp!gRUp=40 CR PPx8p0IS0c0PU XጐPPYPUP ȟ LL  R"4P^0 q  `RQ0010(p RV ( RQ E P 0\U70 7ا؇ؗW0 00  P0 P R|' R  R  lP R LP470 R4  8  (K40Spy 40PA{  R E PvpQPEP0P0xP[  rPQPE`V`vPp 0 0 aP 0 CS<00PS 0IS5%5 0<0 5H` 0D0 5`000 0P< :D0P00p X 0 ቢqpnR pGpWp00P0S 0S yP50P$  4P0  <0 R T$04P<0 $ 00Q |40 p40 4PU001R A P XYY $ 0P0C 0<0 R60\300S V0 P0CSXH`#00P # t30l3P0p``sp U 0PE0PxP  P U30<0 3s000  0 p@@ 0S @2P0PP0UXT00P 0 ]P2  ,0@110? ^% 00P <0P0S lP, ! 510  H = 8R.#=SS S@ @  0 ,0101P\1dT100S i fP0S a]P\PP0S M QIU, t@4ľ0Ld$d0xph<TL -L MdSd3P0\C @00 p0S0  `W_ # 3p@ T10 Th)P b` @P 00 00CS  .P ʔ2 n0Sx20` d20  (KP<BQn(   @DR  T lPT ` R ! :10@ `3`@ `几l1 Q&T `` @T  Q P%     lP l@T  `   p @ReBF @D`@ ^ ` O  p ` R  h R  %P ~IJ$@t,еd|hܳ -L 0 x -L 0 @G-t1t!0 lA M*⤂X5 PP!0 @ P0S& Z0( S!`,ppG\0  R     \0 \00\ 0`SXЍS,P`PEpqV0 0 0^  Q\XꜮ0 00 0Q 2S0l%R h%R //!R!RtP//t 0 000 0/pt -L MUPP; |5p 0q0  Q࠱젣X2`s. Dş8#8 S1005@0Q 0P\` 4  0P 4 $0 :l“@ 0@lQ hQ 0ʀh20d2s% |202,d"d",d"d"+d"d"+d"d"*d" d"*d"@d")d"d")d" d28d20SS\ RfngSW RoYc0SL RoZ`SB Rڪ`ZaS7 Roi~j`S+ Rڪ`Zb S Rڪ`Zc0S R[-²S 0Y[=.0  0S 0Slp" 1=,,0  0Q10 "7! 0:/pbV. !1 0 pA0S! X100S 00H0Y 0H0删 X ,01 0 0 00Q ^2`V(K 00 (K0  00Q 0ʀh2Q 0ʀh2Q t5S 0ʀh2,t`H5 \1P0-0LBH P=P00 Q6\4 00ʃhœ\ 1:p“ @T pƒ 0@Tpƒ 0A\ B\  0    X`,1P-0E 00` P?ʀ :h“2\0 @P)#0000CS 00000000000000000 0-@LMPP@$\U Y͌x#3 P |P 00  (0 K0ꜣtXP- H\P Y͌# ܢ 0-4410L :h2S! @10@ 00S 0 ,Ǡ 0 *?pB00 R  00@S0AS p/`x0 000:d/  0-t@t0@0L0P:h2S S0H0000P000 $ @0 0@00ܠt -Q1P`!@@0L# R#p碋 hQ! Q!͂,Q:0S6|20 01  1Q;@0 78 0@0!-, Q#0S|20l 0  刁Q*|20h x0 } 1Qt 1Q*|20tD/ 0-t0t 00L0@00CS0P0 0 SP UḁPd 00-0CSL@0P0 y0 SP UᚁP 0-000 00L0@ᆛP_0h 0-LPz@S0H H ? ?  Q P//?? \\ //@-Q @0   0 B0CJSR0 p@-P00`@000 0@\1000C1.T *\ /\pR00p00 0L 00*\p -L$MqS80 `pP) 8K 80< @T  F(D @ $T  5/8 080 @TX <0S  0F8#8 S00S= (K <R !  "! ".P  RH >L0 PL0H  ,K !0 80 bX00S P00@  R0SD0?R@P  5/@TD0`0<0B@P  5/@TP 0-LM@ RP !R "R Q  (@0SK0 -LM00 0 K4X 0-LM@<<<0 0P0 @-K0 -LM@@@0 < 80 @@ 0@K茗X0@-DB000 \S@R ^S? %@@; ,S'S \S:Sb{cS10LL A0}dA0C000000000 SPU. 00ES0@P00 01P\00C00L0'000 zQ -LM(0K .$d0(CcX112c0A!!"b L0(!02!1@K赁Nh g 0-LM 0K . `0C@2@0L0 B 0LL0 !12@K0kL > -LM(0K .($lL A0@ 0$4ƒ!b1cP!b1c 0@ A 9 ,!#3!c!b1@K-?L *S0%p - 0  -L$M8  㒕PP 80 `0 8` & 00R0`@`  xx mnΊ@ < ,RH6Ty \ 00@0 008 0 @ 8 080  RS  Qc%R 8 p+0GGSK#IHFEDA@?>=<;:9865420/.-,+*)('&%$#"! [     iT0 S\R 0S0\S 0 S000 V @0pC0@ T$ <000 00 0 0j/>0 0000 00 0  00 (K080  "!.Q *Q080  @0 R@90 SP0K@% 00dW0 00@ 0 d p00@0 8 h90 S 00 @000008 0 $0 S k 00 @000008 0 0 Su<0 00 0pK000008 KD    0 oH  00 D 0 pH0 @0@00@000 8 0 SBPN %00@0 c 00@ 0 S2P00pKD0 6 8KZ%+0c 0@0 0Dh@0 000@0 000 8 % 00iW0 00@ 0 p8 hdP 00(K0pK4D 0K/ꄒ  p-L M@0@P`0S PS"  00 K0"P 0 Q0 Q`00P0H0x 0 Kp:0 Kp耋t|  -LM0S 0K0 0KK@0S pKU$P0 `VP$@U @ 0PfSFPKKD`Q`6P0 ' 0Kdt -LM0S 0K0 0KKP0S pK4 P0 `VP$@U @ 0PnSPPKL`A`P04(0PKHtl -L M0`S(0K0$$!'0K&Kp0S= (PKY0P4耟AP*0< qW# X $@刀0sSPp @TWV 0S h@p$@@ Kp K t 0  -LLMX l ᜒP P0K$ h0 0X K:` R0K @P Pa \ 3s0p0 >0pl0 0SM  R T0KS K`Vz #V =V =`P 000`d0 l=Pw  XV 0 0Y*S\ Ɠ0P\0 \0S0, \0 lhVP fhd0 PSN :`4 @P\P@xr`,p\ h` V AT@ 1 PEh|= 10PP 9h p` VP0\0 (KT@Kc$P 倁 0Pd0 I d` ~0, K$0VT`KF P 4倡 P 40`d0 @[TK+0Pl0aP P 0`@d0 >d0S (K kd`@0H p0< ( Th( f \ \ 400 0S0-L@,08QP P2P,0P0 Q0-PLP@P040, 4P0 -L"00 -p`@PL0\ %\0pS sS lS@ 0\TT  1D!01 CR0@CUPW  -䯟LqMQ`P G PH 00 40RQ yOK$  =KpH zW0 qQ R KhQ %Q rP Q, 40,(K@P%T . ,pK>g01 0DXSXaVU^SRQPONMLKHGFEDCBA@?>O<;:9876543210/.-,+*)('&%$#"! ( 00 00D =P@0A?S@0@0^ R!1! D]R񏐲!~}|{\yxwvuvsrqpPlj hggdE"a`3p]\[<YXXU^ \ -00A|l0@01K0]P(KJ@`VP` 00040㷏P, 0000@T$ 0D, K!@00 Y 3  P ,40 twp 40P4 0pW 0G, K!S00 夐 pG,0K1&@D0p VT)s'&%mD"> 4!B;Z    $30@T @D,0K1S0@ POQ9 ?Q  ;Q  Q0 0%Q a0A RA0AS00OS3 A, K! ,K!000 1S101 1Sx10x1 0@T_ @Dp,0K10@ P DOTYw10A R0 OR,K1PT  T 0 0 R ,0K1X@ BT0 ! Y1 *P ,40 ~vp 4004000@OS ,K!!000 0'SS 0S'S'S00S  0C, K! 00 RQ  ?R ;Rn PeR~ Q %Q0  01 0000 0B 100 OR,K 00 0}SS 0S}S}SVJ0@T @D,0K10@ a0A R/, K1 90pW pG,0K1!T0p ' ~T 0pOW,0K0 00  R  B0 OR,K1 ,0K10,K1 0 00000&@D0VTm|yQ00&P I0p0 ,0Kq1@ 0@ :00600< P$ -0!T0y ~T F  G#0060pOWQ0, K1!p夐0p ]0pY0pY I0p @0p0p00pY0pIoᩒꔀ'0pY }0p)0p P0pPi 1P @A0AS3AՕ/o"P  --LM 0  K --L M 0  K --LM 0  K00/t -L M`QPp@. 0S0T0 00 KW& 㺍P X * 0x09 X*T QTi K`P *Ppp0 0 R0S TD -T,'T  T, Kp 2[S "[R1 000ST00iP \00l^P \00@4x 0 < t ht@ p L ` 0R -L MKF@P ?K -pL@P% T% R`PV @P|=PP0E?V ᝸o ᖸP -PLU`p@ /ˌP T " -RL MPp 0`BS@%  p7 0! p0 0$p) 0S `P ` .`K B[@ 2[@S@@0 2[@S@@0 2[S 2[S 2[@S\ 뾂[X $ P $0(K 뾂[ 0@X $嗍0 $0 0$Xp 0S0 $ ა@p[ A @nR  sR fR  0 (K @R00W0S0 0 0 0 0(X0: A뾂[@X  8 ྡྷ[3"[@R AW H(X@  뾒[@Yo oI ) ਂ  ྡྷ[ "[0 @ YT 뾂[@XC H(∀ @T2[ W Qp‡X+000 02[@S@W   @~0 0?o"[2?000 @0n0% -Q@!LMPp0 rt P 000S4 P(K#"`P 8PK4pK 0p"p 4 RP"(K80S! 0 qPP PP 0 00PP+ P4 *!`P 0KV0 0!"P84 j` Dehh -LM MB~K04 ` pG0:S(0@:SS 0:PSPSPU0D R00X0S  ,0K 04 TL[P 0P`:S (K`(K -MLM@ 2 Ÿ0` Pp@P< 0/SL P Z PK P 0 (Kh0P BNKT! @D 4qP"8 0 r(K0P 0S/S @P ᶋX 0  0 P BK  @lp 0,,喋 AXT <000(K,000b H $ ( -LpP^P pd`P@` @T0 P00@0A0$Kk= `B,B --LM@00 00 K 0-@L975<3 1/,-K0h) 0-@SLP:0S !P0ᝈ -L M P`Up@ &KfV@@PU  2[S nV@ sV 2[@PU@>00 K -LM PpU `KfSPU  @7P[ 0@nS sS [@PU@00K@K -L M@Pp P:`V,*0<oP+ D0<,K`a D0<0 D0wD <0` nWD p) sW2 fWD0< DH00H0(K0 (K<}P0`Z 0 D0<,Kഀa >D00D0D0 <,K a 2D0<0D0 *D0 0D0 t -L4MP0P X0 p@W `V $4 D0 P P0  ,K0Aa  T0  XTT0,K@ᾑa W@   @,Kẁa V@  @p`W,K/ 01a ,Kqa@   `(@pT,KCAa 8@`T,K(@a Hp@W,K pa P0D(Kqa  D00a,Kpa` < @ 400a~,K@a `x ,t` $00al,KAa` f bp@-88! 0 @ 00 @R9 ^  R@. E^\R  :Q  R@ R Q \^^ @R Q @ R  @ @0X -L,0K|M,#l ,`0 :`P0|0  |P0@0@|P0P0PL㡇P 0<0 80 ԉP U l0T l0,`sP$ 0S! l  !  "  d 0 08C8st h0 ^ h s,PX ,`LP 0S d .S  ROS@ = `P# @P ` DhFhvP  nP @KV@0@0SP v ]P  $0,KRa m,K$0Ba0$0 d$ (0 0$ (00TSl0 P@4P U0<Kx0 2P p<040p0 \0 700 \` \ 0'\\00S}WC%PUP^\PU P@U0\ 0p 40HQ4 *<0 Cr\h rm ,P 40t ,,K"a 404 ,0,K"a40 40,0404 <4 8040 4 80>0pL0SE0L/S'%$#"!    p@r @0@Sn HDHtP  ` fPP0 0 ,KAa  00P000| 40@ 00@> 00@84| 0000  P@ \0\ P(<v 4 (K@0P0 CR |  00 0x l 0VqV0pGWp\0@p\ p@ HDHt (B(r@U Pn&Py P $0,KAa  ,K$0!a 0x l0P0P 0 lV 0\ 0 P\ @p 0\ 0 0\ 0 0\ 0 0\ 00\ 00\ 00\ 0χPq (B(r@ S0l  000 f0 !᳇P\0 0 ls 0x l P@k=<庆 (Kl   0 s0  ?U0P% 4 0 lKl HDH 00@ n0 ,Pst`PZP 40,,KAa j40,0,K40 aaa4 80 04 80 0 l@lX  PVp  h P/ p-L4M0H`K2P@P KpiY0 00S !R2Kp - Q !P 1`pPL@7 0 4S0 00"0 P,PPp00|PQP`  >YPpgŅGPQ  2Y|0P0ŅPPE00 Kt 0-hP@PLP ԅ҅Ѕ ΅$̅,ʅȅ00 R00It0 000/PIt$0$ 000P/ /,ItT$P00// -LMP00K 0,0圃c!1!1"b2c L0@ 0 0D0`@B!A@C0P$K赁N| g P01cK// -LMPK00K ,00 a` B0C 0"2@0`AB@C1dKP$KkL >( 0P1// -LM@ 00K c0,圁a L0@ 0$4!b1c!b1c L0@?AA0 T0 !S1e1cQ80PB0?NP$K-?Lp *S$ -L M`p{ 눀 00@0Ps וP 0"P K 0@PE -L(M'rrM26f=>b9|{zyxmMutsrqponmlkjihgfedcba`_^]\[ZYXWVUTSRQPONMLKJIHGFEDCBA@?>=<;:9876543210/.-,+*0c\D0 p|+ <@ pPUZ"<"KDKb P(0S% !00,0( $K0c\D0 5+ (<@ p0S0"<"KDKC P0S; 0 0!00,0( 0c\D0 [|0 "K;@ 00sSt0L*0c\D0 E8* L;@ p0S2":"KDK P0S; 0 0!00,0( 0c\D0 ʰ) :@ 00S"`:"KDK Pp ,0( 0c\D0 \) KX:@ P0S DK P0S ,:@@@w% 0 T\"00,0( b0c\D0 ( K9@ P0S DK Pg0S 9@@@O%h0 ,4"00,0( :0c\D0 ,( K9@ P0Sy DK PT0S 8@@@'%0  "00,0( 0c\D0 |ʔ' Kx8@ P0SK DKZ P)0S L8@@@$80 "00,0( 0c\D0 Q& K7@ P0SW DK2 P0S 7@@@$0 "00,0( 0c\D0 Id& K87@ P0SZ DK P0S  7@@@$0 "00,0( 0c\D0 @50U@0 0 1"K600S DKP= ,0( 0c\D0 lş 0 @ y P66"K600S DKP2 ,0( d0c\D0 ğ 0 @ 帙K5P0S DKP60S50 0/7!00,0( =0c\D0 hğ 0 @ 呙K5P0S DKP0S40 0!00,0( 0c\D0 # 4@ p0S"|4"KDK^P0S\40 0!00,0( 0c\D0 L# 4@ p0S"3"KDK:P0S30 0!00,0( 0c\D0 " t3@ 00Su"3"KDKP ,0( 0c\D0 3p" 3@ p0S "3"KDKP0S2(0 0!00,0( 0c\D0 ! 2@ p P0U"KDKPl0ST20 0bj!00,0( pc\D `@ pQ* 0"KDKP0S10 0>F!00,0( L0c\D0   K`1@ 00S DKP ,0( 6D ` 0 D ?t @ 8 X L T  @ x  $  l p 8  ?8 D (  p @ ؾ $ @ 4 G  ` T $ D  p  ĺ H ` 8 ط  d ض ̶ , ص p  $ p T c\D 0@  L1@T" 1"K 0㰍PDKPm ,0( 0c\D0 ʸ! 01@ p0S"H1"KDKP0Sh10 0s{!00,0( 0c\D0 @" K1@ 00S DKP ,0( k0c\D0 ʔ" 2@ 00S"t2"KDKP  ,0( U0c\D0 " p2@ 00S"2"KDKP ,0( ?0c\D0 ~< 0 @ 哗K2P0S DKP#0S 30 0 !00,0( 0\D0  ~\ 30@0 p3 p0PU?"KDK^P0S3 0 0!00,0( 0c\D0 `$ 3@ 0@T 0"Pp404"KDK3P ,0( 0c\D0 $ p4@ p0S"4"KDKP0S40 0!00,0( 0c\D0 X% 5@ p0S"5"KDKP0S850 0!00,0( 0c\D0 % 5@ p0S"5"KDKP0S5(0 0[c!00,0( i0c\D0 h& K,6@ 00SDKPc ,0( S0c\D0 ʼ& x6@ pPU"6"KDKPL0S60 0!)!00,0( /0c\D0 2D' 7@ 00S"d7"KDKwP ,0( c\K#KD ʠ`pbKx@ `Q DK^P0S70 0!00,0( 0c\D0 (( K8@ P0Sh DK:P0S48p0 0!00,0( 0c\D0 wʰ( K8@ P0S DKP0S80 0!00,0( 0c\D0 8) 9@ p0S="49"KDKP0ST9 0 0x!00,0( 0c\D0 g 0 @ ڕK9P0S DKP0S9 0 0QY!00,0( _0\D0  \H \:0@0 T:pX 0"KDKP}0S: 0 0+3!00,0( 90c\D0 b* :@ p0SO":"KDKPV0S;, 0 0!00,0( 0c\D0 0l+ p;@ pPU";"KDK]P 0S; 0 0!00,0( ,0(  0IUK!00,0( , SK"00,0( P, 0*XKx!00,0( , LSK"00,0(  0UK!00,0( , SK "00,0( 0- 8- @- H- VP- +X- (SKt!00,0( z- - - 'SK"]"00,0( c- SKO!00,0( U >0. . _ SK;"00,0( AP. u 0ᙔUK*!00,0( 0. >"K 0)PTv"00,0( V . o P>?T"K/"00,0( $/ 0SK"00,0( T/ \hSKn!00,0( D( \0SK<!00,0( ( *SK !00,0( ' %UK!00,0( ǟ ' xSK!00,0( h' ,\SKF"00,0( 8' 4UK!00,0( ' SKz!00,0( & Ɵ Ɵ & dSKd`"00,0( fx& RpƟ (<SKwO!00,0( U<& eDKPi ,0( K60@0 60@0 30P %Q5 9㠕$KKP $K 5p 0q{P ,5"K0S!00,0( ,0( ,0( ,0( ,0(  ,0( ,0( ,0( ,0( ,0( ,0( ,0( ,0( ,0( ,0( ,0( ,0( ,0( ,0( ,0( ,0( ,0( ,0( ,0( ,0( ,0( ,0( ,0( ,0( ,0( ,0( "00,0( "00,0( "00,0(  0K!00,0( !00,0( "00,0( !00,0( "00,0( }"00,0( w"00,0( },0( z 0גKj!00,0( pd"00,0( j^!00,0( dX"00,0( ^R!00,0( XL"00,0( RF"00,0( L@"00,0( F:"00,0( @4"00,0( :."00,0( 4("00,0( .""00,0( ("00,0( ""00,0( "00,0(  "00,0( @10@0 410@0   0OzP 0"K  0DzP"0"KE00 0!00,0( !00,0( 00 0T $  X  4 Ȳ < 0 x ( ( ! @-DT?D  H, ( "- L@0P Q?Az `@4G6pG/60 /0p!P0C`@T0  P 0CP0C B@0PU? 5 SPX P^! 0 SC%R0C  G   @lpC04@P056Q0@P0 0w 0[P t` 0\ 03P t@`P l0 M0 0V0 {0 0 @Yn? !-A*?B0CSL@Po!S5H!R#  S QÂa@ 0  0@P3S S 0@P0A.B B32 00Q10 460n0Ƞ#6PȠ7 P 0@ۏ0 1@_ /0S P /? @4@P/ -@08LPp` P(  (8/P87 , R 0(40!, 00R40GPBV: `V# G 8,04`00G,0400 40, 0S4004000R`0`` P0-L& 0S# $0S P0I R 0  SpTP0  $ < @ *@˂004? P-L 0S $0S e0P ,00040 Kh -PPL@% 0S" $Y LPQ`@aD/T@0DTSpp8Q (0T (9/8p (@$Kk -`RL@3 8S1R  -P/ 0 S $ (R 3/PP p0P@8p0`P $0(3/pP  (0 0$ R0  $ ```4?0  0-@PLP 0S $0S PQ0 Q @  \  PQ'%  00@Ddh` 'wf=L.00` SR: 30YL0|0J p@X=0Uy 0PEt@T<'<'$p@0(0L-000 0S 2=L 00P00CSTP ,0L 7s@ Q<0(0 S0(0 @d<,K0a pL<0U0 0PEt@T0SpH ?N?O?5? 4 A?H?@ L? J?9?:?;?0X p0P0Xp0 t P l5L,%00` 5`05L\%00q@D `@80pD0 E@ 5L%00` 7p` @ s Q`:00 PlU R~0PEt@RxU`6LP&00` ZP 6R0[`LR  R0PEt@RU='''<3K2K 4K4pK10K#8l0R` 1YU d` ``U PEt1@Yd`7s@DQț7~@DD@p7`00S<0Cb  0t48L07p` @q d$ R'400  0 '4 4K4pK30Kp8@0;8l0'4 4K4pK30Kp@0 \7p@D 0@D''q10)S ?0S%T9L00` L<0 080P0`0Xp`p0P0d  0VP <:L008:`0br\:LT*00 `Y`Lq@DT p0\ d dT0 \0` 00h /P :L00:`0;@L`p6;@0 ;L+00 -@PL 0S $PU `P(80S 5/$P(5/00` -@PL`P 0S $0S pP@0 QR 408 B400 @8U000p -@PLp`' 0S$ $0S! PP 0R| S  P00S   0S  00>?R? 0-@PL 0S $0S KP0  $000 -LM`2`"0`PP0(0 0S $0S -P@pT7 2 Rv @< Q0@<.,K 0A+ K S 0 <@ P00cS R#2^ SࠃࠓP0S@0S60l0@TP  N Q00cS R#2Q S Q0Sl0@S@0AEX0@0( 0R $Kl0SppPS??? P-L 0S $0S P0 Q@oA? -@QLJ `VG $0SD wXP<!(P6/`P= 8pW  ( 0(3/pP, 8   P0S0S *p0W0C0p0  (08#{8p`o ST0C@0P0T($03/ P-L 0S $0S P 0:+ 0-@PL 0S $0S P Q 000 000 P-L 0S $0S P0D R , RD0+0BD0C?L? P-L 0S $0S P S>p0@@G-M@@0@>0^QR APQUA`Q |^ `\X PU V`! V! 1PU `vZЍ-0  0Ѝ^ 0Q0P0SP0e`08#8V0R @0C 0S P0RS`bC0P@R@0 P2 0 PSЍ0,4000000@?o280@0 0<0 00 $  B( P 0S03`05 :U`03P340%PE P!0'050%00%P!( p490C1pp Rp`P00L3 0S C@ $Q0 B("(R$A\Y   \?( @$ T:  Y `(\ L (*Q BR PP BRPU : 8 Q  Rq, %Q  Rk

# 04ᾀ W@pH0局&R Bp08P<0Q*lPt `Q *P0CSP18 PV(K, Q*PF\0CPSP18 6PV(K -P`L@0T@!T  0  0CS@B @000 -LM8@< tP, Udl `0pp8HPXT D`P4 H@Q x0d`p P,BA@@\S`Q^h0S/ 8 6\f PV !9096&0CR \0l S8 B0l0\0 l0 tP0PERl0tP(K0tPPE Ulh0tPt0 S< R S Sl `0px0d`0l Sx0 PpB QS`d BVv!fA0Ct0⾀pv0A01I>Q2L0!8ӗ1х1&=  tP6xpl P0CPEG40 8 0 tPx0\Al0:8H X`T&" D`4ᾀH @ ᰀ0Qx008 4p0 pGRlph`0\ 0R8 G l0\000Sd tPPP`}x0l %hl QR010#<6P) 6SK \0S8 B0l0\00(K8&VP0 ) )l h0\0S8 B0l0\000S(KtpT H4-0 L$M4 t@pP@0C8#8T0ƈ 0C 8!I.S# ;#8җ1Ӆ1&=  `t 6QN0C^0C?ol \2t0 8X`Tpm0 `lH f"`H`S= 3^Ol08H XT " D4@@QH 0 , CA/B BPq`&PF8P0ƈ09096&0C0C?otl 2N Stl \0l S8 B 0l0\000Sl(K It1Q40S Q6 Ql0P@D A8 @ L < 4 @@ @H @ 88 <`D H0 l0L&# P0 0\H P`D0 H0L@8lm l0`l04S1#*\ &R \ R8 C0l0\00(K\ R8 C0l0\0u00S(K,pT -L M` ,0IY0 !20X0T0X0S0D SpHor 00 #4 B $ B B  0B/U"T6WC6@*01T[:\ lPPE@D# 0S0S@1TP1 T:XpD pGopr \08  \ 00 00@DA TPP\  -W  B@  @ 00 @SP ,08Su A t, l 6\ AQ@@UF (K00 @Szl 0 \\@R300 P V0Spӏ S00W #̠ #800#"0 p0oS0c0ŧrj0S=0 p000` S *SC00 6R;Cl ͟R 0 0C0#2 2c0# 0l0S  00#  #800#"0 q000Q0S09S ES IS! [Sg gSg  R]YV$ 90S0(0(K/0S 0>QK  J Y:3 0 X 0 Y %*I 0 ,0 JSR  B00V X; R( RdR@0aR00]  , RZ0 0I000S.  0 0S0   0S,0SQ: R,0S  R0 B0200 0[00$0S,0  0$ 0S0   0S,0SQ: RM t00   0 0  RC 0,00Q0Q0$ 0Q00R 000 0 0 0#40 0  0 0 S0 S00ӈ R01 0 0  0S 0 0 0#40,0S E0 0*0,0S)  R0 B0y00,0g  S 0 Q0S 000#40X0q000S 0 B0J00 B0C0/pVy 0 H V 0Sqt6l 8`Ƙ Რ &!909&tl0 BI0Qtl0Q Yt0SVF :V㴖o 6S9 \0l S 8 B0 l0\0k00 00#400 03 0  0#400  0 \ R8 C0T l0\0*00S~J0 0 0 0 0 0 S0 S00ӈ R01q 00 0S0 0o020 p00060,0 J0[0L D!B t0S*l0\064p p0pt0&l8`Q  A R, *6ƒ᱀9096AAot0l 0C t0l Qu St0 SV} S S`l8 R R,  00 ZZZZZZZ0J?o R20S00 B IR` `0 R 0B&Ɛ0 0 01I>001&=  AAo`t0l 0C `t0l $BpT\0S8 B0< l0\000SN4p\0l S 8 B0( l0\000S00/*V4p6 &R \ R80l0 Ct\ R80l0 C0000}00z00w00t00q00n -`PLPpP 0SM $0SJ PGq@A Q00W0S=0S 1 0!1 0S yp* 0S1 U Qj6S S L D!B @06| 0 1 0P |0p0PL D!B lԕ -@PL/ 0S, $PU) w`P&0(pQ 5/0$P(DQ 5/0$P(@Q 5/0$P(8Q 5/$P(05/0qW`0` -LM`20 <0 0\0 Pp40  08Q1S00P 0Q} $0S 00s0V00 `f0V00`FGQxFQRt4 0 QRoFoS㪢Z80 gV @!( `4/@Pn *! ⑂80@ 00A402P  CX0`,L0T  0 P(`3/ 0 8,(3/ 0 @L(3/pwjD 0 v(3/68!Q ( @ R% D PR!  0 0600&040$0(Koh0<0( 0$0S|d0<0$0w(K@ @0 < 000ȱ -LM 0 P 02 K -@QLPm `Vj $0Sg oUP_8 p!(6/@PZ l!@ܻ 0 ,P(3/ 0 8,(3/ 0 @L(3/D 0 (3/8P4 @0S1 ooD0bS`V*, 8 ᰻, @ @嫻L D D妻 墻0&0C&΄ 0 0夆$0˄+RC-`  d 0 R0#01&d#R PB$3R@@0B  ` tlap |q`& `&&, ,|,d `,Ƞpl a ̌   ̌ t ap |q`& `&&, ,|,d `,Ƞpl a ̌   ̌ t ap  |q`& `&&,  ,,tap,Ƞ| q`&̌`& & h`l | Ġ aq̌`& q&, ` l Ƞ q  ̌ p' a'T`&lP RPB%Q@ A ` l 8 q 0<p'a'T`&P R< 4 00#01Q&d#K HK H TH G-RBM[B(0@A0T0 `P0S p,0V @p0S P,0Y P0S @,0U@ P0S   ,0 UB!0 BߍP 0 0P 0 0 /(F 0Q /0Q /tsRpC-&`P咆Ǡ 6l2B@ &'!8 8b" N 0C0 L  D A R,A B4P C$0@P @@ppqG-R* Ƞ Q R RIVB0 N@W]0T`TT 0 `T 0 T ` 0 T0 `T0 T ` 0T0`T0T ` 0T0`T0T ` 0T0`T00@ 0UhH7F`FcV2 R0JLRR RuB. @B0P`P PP ` pPP0 `Pp0 PP`0 pPP0 `Pp0PP`0pPP0`Pp0PP`0pPP0`Pp0PPP`0P00 0T>n B"  0 Q 0C7'bc"2JL 0 ZJJ|0 \LL R  0Q @08Z!7&cJ2JL 1 Nq,/a U/ 0`0/ȅY \G-:PT0/SM %pQ͌0!S /\˞U A@`kṐY @11: W: 0@Q=0@T! Ѝ QQ Zࠁ -LDM @0 ` P 4ZVT TP4p QQ \0P4p\+ VTp σ pT 0R  !QP4pT XA   A&SP TÀ qXQ=0pP4!\ 0C` P4 ` `T$`; BX T$T;! 0QQ=0 Q0"0202 0 `kd0 Td>n 0\ `SR0/ Qh P\0 !ap0100PP0 \0P 0\0 P0Z0pYpp` 0NP0ն0P0 X0vSP0s#6 X0v`00s.X\ hRK P Y> 00`X0 pn@Qe  ^0BQ Y> 00A .0I000Y0C0PP# X0X 00aY^ P@ 0`FqZ 0S pF0@C$F^P@XHX0d LK ( 00\0T r 0@AQ , K"^ "N Q 0T(K 0=A-P@\A0RP0@+}n\( \ 1>000R R# P0T0S R S PR00 P0 S0Ѵ000°0Ѵ0P0G-鲀MXPPRJ@!z00k`0 Vᶠ?Z3 V:৞ @@@0 0@#4@06`V cP\ V &028@aC8RHPA$H0`V@6Zw Z @P0 0R0 ЍX&0i X" @28C8PlU! ` P0 0P#40&L0bTC 8@C8&@28C8PlU!p P0 0P#406 LcT !&`FhA&hRN0 A 0#406Z cVb0C`6@ P V+7ʰP28C8@lT!  R&AI )0"(B(   0#406 cY 0C⸐6R @PU &I &P28C8@lT!%  R&A8 I )0"(B(   0#406 cY 0C⸐6  `&O @0 0@#406 LcU ! R&A `Fh&h & @0 0@#406 LcU ! R&Al`Fh&h &G-Z M6k SƕN ,4`0 0 400400400400&@<@N0d( S"(0    0#40ƕ@DlQ.( Nƅ6 ` S08QC8 @|pq pp<  g`8C8( V"(`   0 0#406` cV"G("( ƅ0(AaB(V! t1@fN.,(B(8 T#8s@000  0@#40ƕpF0l^ (B(ƅAQ0003ӕӅ0`0,@8C8pd( W"(Dp   0 0p#406D cV"("( ƅ00CTNm `4`dA!N( V"(J6 S `ƅ^@0Nc( Q"( k> ƅ Ѝ ƅ| ƅ0ƅ`kp p  `"$` 0C `0T" 6 ЍT tT hT \T PT :&@-R Rk.  k &k.@@ "$ :&@-R R k@@&  B&k.@@@@!ƃ0@-P0 @ K@ +,K( J&̀8+k. $ˀ0PG.V 0S 0 ,S0 + Q0I0&&&&0r -k~L@ƞ8#8 @ \`P(8 ⸀ "$ &bS1 B0&[ 0  8#̠  4##<00 0PP⸀ƎT0@-@k΁6 S#(B(.+0P  0P#4P06 cTB 0C@6 S0Ҽ60k.@@0@@@#4 06 0C60@06 -LM RpP0 , R I.0 40 0`&M80 @+(+N 40 BR7 pQ j \ 1! ^3 "Y#0kS\0*! X8%8#80ἆ( 8 XC8< 4 /A!88C8k0 00#4 0缆0hQ38#8 H0ἆ48C8! X8"8C8k0 00#4 0缆0hQ38#8 H0ἆ XA0B8#8(B(k   "$ 缆 hS28#8 H0ἆ, MkΆ00#406cR! 0CZ 6ڼ0 / ! X88C8!Zἆ8< c4 ` C 4 P  \ I0 ,  R3 "YQjk>&MI.0ἆ@0 XR!0(B(k   0#40&0bQ3 B0&LN.V 0G. 0R < S >+ 0 Q00W0&&&&(K(Ko &MI.@0 j 0 ("(8k.0ἆ8C80 00#4 0缆0hQ38#8 H0ἆ<A!88#8k0ἆ0J8#888#8k.0ἆ8#8k0ἆ+R+R,R I.0 EPK R  EI 0 AdK H G :Ɠ0@-V@Q@F   !I.AQ!ѕ"х&  & BBo0) )D -LP`@? h0P `0P @T @c@V$@T yaratcid -LM$@K`p( KPP K Ep (HTK蕸P 0-SL@` Pp0Q C `0QpDW p#pDVyaratcid -L M K@P `@oK -LP R -L M Kt@P G@oK -LP 9 0-L@P 0@0 0-Lx@P &@0  0- L@P @o0yara -LP   0- Lp@P @o0tcid -LP  0-LM@KP eDp  <O@PK0ݷ@K0ط@K0yara 0-LM@KP GDp  <1@PK0迷@K0躷@K0tcid -LM,PK`p0 K@P  Dp 0OS 8@P @ K蔷@0@STtcid 0-L@PP 0P 0P0tcid 0-L@P (0P0 000loob -PL`@PP  P 0-LP@ \0P 00 P P 0 QPrbmn 0-LPs@ \0P 00 P  P 0 P0rbmn -PL`= @PP  uP~ -PL`5 @PP  aPj 0-LP*@U d0P 00; P: Pp 0y 0 QPrbmn 0-LP@1 \0P 00 P  PZ 0G P0rbmn -PL` @PP  P -PL` @PP  P 0-LP@d0P 00 P P 0 0!QPrbmn 0-LP@\0P 00 P  P 0 P0rbmn -PL`d @PP  P -PL`\ @PP  P 0-LPQ@|\0P 00b Pa @P 0 P0rbmn 0-LP0@[\0P 00A P @ @P 0q P0rbmn -PL` @PP  2P; -PL` @PP  P' 0-L@P$0P 0A0gnts -PL`@PP  P 0-L@P$0P 0:0gnts -PL`@PP  P 0-PRL@ @0 0-LN@P 00 000Y 0-@L0P PP0 P-L 0R P Q 3o 0-SL@P T``$P8KhjP Kh< -LP@P ተp`NP  { `T@ 0-LP@P Pn0 000 -@PL 0 0R iPP 0 00  00PM`P Q  $`PW -PPL x0 0R9@P M`P Q #`@@Vh~ P/0 0R /Kh 0-L@<PzP0/sP Q lP Q>dP  K0h] 0-SLP` @ 0S MP@<EP QQ :P/4P >/P  Kh( -`LQ@ 2>Q# &Q P Q' <QP&PQ  PhPPQ PR(0S0$00`>S@ /S~ `(`  R R00/R00>R00 B\00S{ R `R  R R00/R00>R00 B\00S0FU0 S VwP0/S0$0 0>SH SQ  0R R R BR  R  R R BPQR 0 R R=R BPQ1 R   P P=P @\Q! P|`FVy0S0(0{r0``000 0` 0 0 ǩ 0B00"SX0 S 0R "P P0J C  >RE00. 0 @0 @-\ <\ AQ R\ <\6 &\@aT lTt\% @mT pTo\s\;\'gTt\;\>@pT@;T;\<S0SqTu\o\t\;\" Q-0L  `vo -LMMMK`X1QK0H1 O?KL1 N?KP1 SSS@PiK0!S0-S0-S0@S@S -S 0-S>Q@@, , FK -MLMPR`p^P 0S +@0W 5 sWV /R /.0BKH0 0 S*  }p@0  ::U< bPd:;\0P KV? 0  K0CW /RW  C B/QW0@C0@T@!BKH ҧ0$ K@4D. 0  K0:p :P:Dd:p :9:p0P<+  -LM` P7H@PE3 ,9pE Km;pG dKe0V@p `0 0 `/9p)  T  `0 p 0PP$K0`p ` 9p  2$K;@\J$K9UJ@ 0-@L :K0hEJ -LzP 0 0 ed% ' &  -LIMMK@ 2NK00 kPX @AT{ 0 R 2/0pPzf PB0mK0 3/U@ 5/T zT T@AT8A 3 p0S7 03/P Z :/{z81pS @0 R 2/0Pxz$ P Z :/W8 003/U 5/mK(K 0 0C/ 0 0C/ 0 0C/٦ 0 0 Ц| |0| 0 pǦh h0h 0C/\ྦ|# % $ X# % $ 4# % $ # p% d$ F" H% @$ <" @% $ ! -LP@P-  PPgI$0SP  RlsP P IPP 4 `PPP0$ 8Y # P0/ -@LMMMKH T! L 7T0 HL00D! S@! ,S/KmKQ_KNKOKP! RK T%`0P! \P4 HL0 @04/@PSoKR_K@HL003/@0 AP(KT@D1L!HP <80H SL D! @! (KT!R00 0 0K/ 8" !  0/0/ 0-@LK0hH ((-L; Khpx]] (0-@L)H0t] 0-(@L@m0<] 8 00-0 S @ UT:0/S  R0P0/P0- 00#0 A T0!RSR0/T0!R0/ -PAL@pᷢ`P (EP 1អ`P  HX`(0( (0 %[t|d6D , D ? p-L,M PP< Ao/ -PPL@C@P@DP`p @C@PMFp4_h0,p0P4080<0H/( T ((-L Kh(S 0-,@L@ ⡠0S.xu 0-L@/K0h+ p-L M@P4 00RBS,0 S R$ 1`V/ P` 00 P! 40, 0C40P- `KpS 0 0 EEKpR Kph0h h0 `X0X X0 D0D D0 aآ    b4   qT l h  L H -@LP,`8DpP V 0 !x,p0PE,p0P -LM@P pP D!0  T`P (0S; 0  HP (0S UE!0`0(K$`V00 00KP 00S`  P  P X  `0 7P %E( (0( 0 K O     < 0-P@L@20S 0  Q <0 0K0h"1D* 0-SL( (0( 0d  KhD`  T (0-@Ll0N -4PLUp ,@焑Q ` 00E`£P #A焑Q  PX@ @X@  0 0| ԡD  8 z 0-SL  P< P 4Q ,00D D0D 0 8ૡ0 000 0 ࢡ( x  c|  p 0-PLP X0 0R @P|0 0  0 {'   { -@PLP` 0 0R U ^P @T @pO MP@ @T C 0  0 B'    -0LS@` dPPqPP Kh 0  0, \  P 0-LPB@P H H0 0 40 0RP <0 00x% -@L MP`40SO &P@(K P 1 0R0P00 00S 0O dd p IP P zP P 0 03/P 0pP 0 S 00R 0(Ko!0 00CS 0 0pS pPH@4 404 0.(q $$G p    40-SL , 0C!40R  Kh@ @0@ 0-4N, ,0, 0- E,      -p`L,4PP 4 R @, 儑ᄡ  ,04 儡@ 0T:804 80 -@LMP`80 K KP 4 0Rp` S"*,P'0 B!T4 <0 B04 <0Kd d0d 0.X՟P P0P 0.D̟< <0< 0.0ßH < < F$ ,  G  H P-L@Pp1 `0VHV. 404 S S6 H000,  0 0,0 000,0P , 00/o00"\ R `vt`P* i g d b` RnP`D D0D 0^/}X, ,0, 0^/ OT H 0 $ 0P 00R/h 0P-L (00RP800800 0-@PL80080K0h  0-@PL 80 0R@ 0P4@0 0-LM@P d0 0R@ K0P 00S@#:K0@L 0-@PLT ,0 0R@@0 -PPL 0 0R4`40S @40S,0pP@`B`l -@PL` @0 0R@ P @z0P /o40"0\ R00\/T -LM@PP t# Q (K40 Q8 `H0 K FpP @P9삟 ┛pP 40 Qa 4Y3 <0,0pP<04  ޠp,WS<W^Woi>Xj ((0 0p 80  ZpP: ,00 QV  < 80 P80< R B0 / I@ I!@0 4<,0 q1P4<Pb},>vX* yp< >!4 <0, 0pP4 <0][| |0| 0.ph h0h 0.\T T0T 0i/U`? >T 4 H 0  $     -L`SPp@ T  P 1@000 $Kk@ 0 0o/D   P- ?o82 ^0S 00 SL0P/ 00R/  P/?o, 2 \0S/00 S/P- ?o02 ^0S 0 SP/0 000R/D-P /o800"00^ R  R 0-LP @P P 0 03/P P @0?@0 0-SL@`P pP $P p<0P  pKh7 -LP@PP O PP S?衣`M?띣` 0-L@P $P0P< 0-L<@P F00 0004 0-@L0P ??0 P-L 0R RP0SXio808 80 %$0$ $0 , - 0LS@`5 LP. @X1|qPpP P  P XP0U UB#10@U"B< P*0? H@,KocX% XpPp@%1< $B @P 20000P X p=P =P ,Ko  -P`OLMp@ϟ40 000 0 <0 0@0 080 @Q pA QWpp Q <Q =Q 01P Vr Vr V X YxA Qo Q Q Q Q_ <Qg =Qe Pb @PY^ 0A!2 0QR Q Q Q Q <QJ =Q@ DPA X Y<0A!10 Q0 Q Q4 Q Q <Q( =QP ΐP X Y 0A Q@ Q Q( Q Q <Q+ =Q L ⮐Pp(K`PaPQ 0A QSS Q <Q =Q ⓐP`Q 0A QST Q <Q =Q ~P X@QQ Q Q Q QE <Q =Q @ hP @P`Q 0A QS: Q <Q =Q QP @^XP<F`Q A QR Qg <Q =Q( 7P Pf@Q 0A QS Q <Q =Q 8#Ps`Qo A QR Q <Qg =Q P_ @`QY 0A QS7 Q <0ASPPSLQH 0A QS= Q <Q@ =Q L P7PQ3 0A QSr Qv <Q+ =Q ҏP"`Q A QP Q <Q9 =Q ⽏P> PP`Q 0A QS Q <0ASP @P`Q 0A QS QU <0AS ⒏P P@PQ 0A QS Ql <Q =Q4 {PPQ 0A QSy Q <Q =Q \fP`Q A QR% Q <Q =QB QP`Q A QR% Q <Q =Q <P-@Q 0A QS} Q- <Q =Q l'PwPQs A QR= Q; <Qk =Q  PCbPQ^ 0A QS4 Q2 <Qy =Q <PP @@QJ A QR$ Q" <QB =Q |P9PQ5 A QR@`PPQ) A QR@`P`PPQ 0A QS Q <Q =Qq ⸎P @P`Q A QR Q <Q =Qs d⡎P@Q A QP QI <Qh =QE ⌎P`Pp0S400P(K`Q A QR Q <Q =Q] lP4`Q A QRt Q <Q =QH HWP`Q A QR Q <Q =Q BP3@Q A QP Q <Q  =Q -P}`Qy 0A QS Q <0ASp\PiPQe 0A QS= QU <Q] =Q PKTPQP 0A QS= Q <QH =Q P@ @P Q <Q\ =Q P0 Q <Q, =Q TӍP#@Q 0A QS Q <Q =Q ⾍P@Q 0A QS Q <Q =Q ⩍PPQ A QR Q <Q =Q d┍P@Q A QR Q <Q =Q~ P@Q 0A QS Q <Q =Qq jP  T $ L 4 p 0 , 0 8 t  D H P  8 < P T L X h  l  p  t x $ x $ | ( d @Qe 0A QSe Qc <Q] =Q  PLTPQP 0A QS& Q$ <Qk =Q P?PQ; A QR Q <Q3 =Q pڌP *PQ& A QR Q <Q =Q ŌP@Q A QR Q <Q =Q ⰌP@Q 0A QS Q <Q =Q `⛌PV @Q A QR Q <Q =Q ⃌PPQ A QR Q <Q =Qt nPn@Q A QR Q <Q =QX \YPhPQ A QR{ Qy <Q =QJ @FPFPQ 0A QSo Q <Q =Q 1PA R} X( XzP<RP  0A QS Qm<Q  Qf<RPE $4 0X JPQV 0A QS] Q <QN =Q PE@QA A QR Q <Q9 =Q $P0@Q, 0A QS, Q* <Q$ =Q tˋPPQ A QR Q <Q =Q ⶋPPQ 0A QS Q <Q =Q ⡋P@Q 0A QS Q <Q =Q d⌋PPQ 0A QS Q <Q =Q} wPw@Q A QR Q <Q =Qa bPqPQ A QRx Qv <Q =QH TMP~PQ 0A QSo Qm <Q =Q> 8P8PQ A QRN QL <Q| =Q #PTs@Qo A QRI QG <Qg =Q  DP^PQZ 0A QS Q <QR =Q P I@QE 0A QSE QC <Q= =Q P,4 R1 0S, <SP) C SR S0<SS@Q 0A QS Q <Q =Q ⹊P @Q 0A QS Q <Q =Q ⤊P@Q 0A QS Q <Q =Q , ⏊P@Q 0A QS Q <Q =Q | zP@Q 0A QS Q <Q =Ql ePv @@Q 0A QS Q <Q =QT ( MP^0S @Q 0A QS Q <Q =Q; 4PE P @R~ 0OP@Qv 0A QSv Qt <Qn =Q P&e RPa =S^  RX  RS P0SL L -LP`PU@4pP  p P@ 0-LP@P0P0 @00 -@PL 0 0RPP 0 00   `V S4pP  嵓pP00PP/0 0R /H P-L 0 0R P`U V $4@P  ᆓV@ P P0P 0x D๓@0 000 0x $୓x H BH  F P-L\0 0R 0S P4 404 0 WP, H P- ?o02 ^0S 0 Sx P-L400\ 0S`oP -LM$P@U`  R t!0 P 0S1K$0K P $PP3pP 0 0 0KP3 $0R/ kP( @P% PUp5P$0 0@/ P Kp$   0 P0"S D D0D 0 850"S d t 4 B/ 0-8P8@P@L0 00X0SYV P/?o8  2\0S /0SP/ 0-@@@LT(@@ @+0@@(  0-@PL (0 0R000P/0 0R/P- ?o02 ^0S 0 Sr 00-SL@P 0$0S 0  P 0  P tth@@ @@0LLL@@808 80 . XT t d -`PL@t2@P@3PPp @f2@P4p \P@GK 8P 1 0RpP 00S 0/0 03/@P P  < 00CS 0 @ 0@S  P\Kh @w@, ,0, 0 4 0 d 400 0-SL@P8S t4 <0,04Q<00P0 0 0 &я T  -LMP`Up@$   P 0  tP (0S @l @0 PE00KK$ $0$ 0  x  B -PpL4cP 40S @,0a, 40a@T:8 408 h -L MSpP`'V@ T 00Q @00 K( EQ@?T (  Kip 0  0F/6x8  0P 00R/ 0P-L (00RP80080l 0-@PL 80 0R@ 0P0@0  0-@PL 80 0R@ 0P4@0 0-LM@P d0 0R@ K0P 00S@#:K0@l 0-@PLT ,0 0R@+@0 0-@PL80080K0h 0-@PL8@@@0 -@PLP |0 0R`w40S,0AT n@@ 0  0O/h 4 ` R -@PLP` 00P@ pG8040S !,0X <0, 0a<0@0@8@D D0D 0S/8(0 000 0S/` `  < 0-LM@P P0 0R@ K0P @K04 p-L M@P 1 0R KpP  4 P"80,0!aV# P ,0P <0@04<0KphdKphD D0D 0W/8ํ0 000 0W/$఍D 0  T P- ?o02 ^0S 0 Sx 0-LP@P P 0 03/P P @0G0@0 -L M0@S K  ?P  $0SKh, -LP@PP  PP 0`` 0\` 0-LJ@P $P0Pꔾ 011/ -@LPp`P P1S„  0P 1_-P1 p` P 0808 80 A$0$ $0 Bd < x  X -L\ ^ \-QRS  0S0 0/ QL R S "  0S € 0 0 0 0 Z࣌ 8 -PR0L,M0Q@ P 0 ` p Pt p ` 00R0S00(Kp`0 ( 0-LM@P0K0! 0K0a 0K0a   0 @ SK0 0-@PL0KM    ![  0![    SK0 0-LM@P 0b",4b4#K0! Ћ K4"40a ȋ K4"40a   0 @ TK0 0-LM0K@P ᧋0| a! $a$"  㜋![4"40 㕋0[$!$    SK0 p-L,M@P`P 0S R00x$P KpKph.0-S 0  0 0  00 0 0 Hf P0U00 R 0S U00 0-@L KT000 0-@Lp00T0000 0-L@T 0 0-L@T0 -(0( 00L0S 0 -(0( 00L0S   -(0( 00L0S L -(0( 00L0S 0@-1!0 ?^@@ !0S0&\ 0@S ^ 0S 0\ 0^ #0 r? ?PPlRP ! @P00 |? ?P 0PbR P  0 0 / 0 0 /x 0 0 1/P 00-SL@1/000 -L M@0@0 0@0S   t Kh// -Lc- -L -(0( 00L0S PLAo// -LM K" Kvt -LM K$Pp Kwt@ -QLM Q Q R 0  K  K0 Kt ^t 0($/(/$/ 0Y.<+ < 0/(/$/R/-` P RJP5l  R\JPt P 0> 0 ; 08 060⃑ iP5IK 038P0 0C0C P 0C!P2H RJ@G 5IP 0 0  00H0 SP RJ@. 0S5YR0<PR 0<@@PP!R  @0!2P@@@2 R@V P//-` PP5W PP 0: 0 7 04 020⃑ iP5I 0 038P0 0C0CP 0CH@5IP 0 0  00H0 SP@ 0S05Y 0<P\4@@PP/8@-@Pы8000 0@0 0#2 /UUUU3333RA- R9  B0 \\ BCC 0!"PpP`P PP @P P P 0PApAPpP `APA`PPP @A A@PP A 0AP0PPApA`APA@AAA0A 0 0  x: S0@- N S  Ss00  Sw00K r0-00w0-00!=@SP@ V F SW ! Ss00D r0-00w0-000S> ) SS Ss0'r-w -  !P> 9: P3 Pt 0 C   0 SC  Sd00  S@ ?00S-0 0 S-00  @x0x00AS00AT 0 C- 0 Cx 0 CS0 SA00za0-00uc00rp00ol00lb00i -L7PPP3 <P.  |p` 0@0:p`QU  P0=S Q`Q@U1Dq@VP!0p0 0 L -LM42|K0P 2t 00 N @`lpKw@S P0r0S00S$ 44H 00Sv0S 4H0 0+ C :R :S?p%:p#48` CR0 R T0 0 pSpp0S@(KPd3H 00S 0:S T <B?p H 30 (K3H 00S 0:S +;S 0R0D0 0R=ʸ"2 H 00S 0:S W \2H0 0:S X X~0T0 0R' :R$ 0 R" 1H 00S 0:S ۜH 10@0+ Cb^L !T0 1!0  ~@1H 0 HS]L0< T!@0R0 0S H R :R ⦜0 R  H 0C0"00@t^ P< L0d H   4YYtYpY YXX WWWpWPL dV `  RL ,R L \Q -L Mb2`p00 S" P@T P2P@:T60S" 000200S 0:SG?(K0X000P1j8Ÿ -Z cP @P-T@" TQ P PvPn -@ vP 0:S" 100S000(K0Sx100$\1 X0 @10Q 10P10:P W00 0 000 0  :Pz 0Sv $X0 x0 ?lj4dPPPOO O| H( NtN hNN M @ \㓇 -L7# -LQ* Q Q  R !0 0R 0 0 DR`q@V PT 0 h0h h0 *@PTE 0 ?T 0 ` L ` 0 -`0P @ 0X00 TLp:@DV@1  0 0R ! 0 !pP   Iฆ0 @p -OoPB@LMT`pB!P  PP 0@0 @@` 00@0 @P HKφ0@0@Ȇpt"PÆ@p꿆pk"i"@帆pTH00 0 X(H-$$ 0  X3긻HQ0  EZ0 AZQ  ;\ \ #&\ \! R P U _ U  \ R  R *T   _\ R(K\ \4 \ \ \H0 >3 SR$K D04 SD FT JP40!R 0 H0 0Q0D @\V PR@  Re R  RV  R T R  >SV‚ P @k PRF UT \I R*T_ Y  \ R Uu 0>#0!> \H\] \2 \m 00DK>SR`40 cKcK` P0cK`U $   L  8 D0&0C>SP40 P  P0.!!># R% P>S P!>#"RPE 01S400C040 0>S0DKR` 0cKcK `P0P#K 0p0 0P>3 00 0040A>34PA0E pP00C00V Դ -L,M@ `p% < Wk<%  \ o\w \4V- @0WWQ>\ \ #&\ \! R P U _ U  \ R  R *T   _\ R(K\ \4 \ \ \H0 >3 SR$K D04 SD FT IP40!R 0 H0 0Q0D @\V PR@  Re R  RV  R T R  >SV‚ P @k PRF UT \I R*T_ Y  \ R Uu 0>#0!> \H\] \2 \m 00DK>SR`40 cKcK` P0cK`U $   L  8 D0&0C>SP40 P  P0.!!># R% P>S P!>#"RPE 01S400C040 0>S0DKR` 0cKcK `P0P#K 0p0 0P>3 00 0040A>34PA0E pP00C00V ЮG-MRP 4@  lD8Ȓ`Fq>SU7 U :U nUT U[T 0 SЍUg  U L&U7 UF0 T0 U<  SU 0U U. >s  U U U >s < P5  BpB Ǡ \ T0 V 0 U  "U>s > Q UpW 0 P PPP  >S UP >P>s W  X 0 rT >sRP c8Ѝ -LDMpPL A/P P00QD0 9@W< 00 0 L4 0Xc 00 P3`@ 0080 03H0 9 T 80000  _T  R?00_T@@T 2U  X 80_ X00 0S RwA_EPEUH0L 00000 D0WPw 00 4 p@@0S6 TR  Ta `P XD  X} V2U X@ 800000_X0S6  TQl 80000VQ# T@ Xp 4@p!0  `VT@Xp T5  T@ `PP00<00!00U` VQ Tw<00 T<0PPj <0P,`0 0 4 jP000(K<0PPP00<00`P00`P,`P0$P0P000T -`LM0Vp0 6*0Q>3Sq S1 Sl S@n S S04  E0@P0 Z4`0 Pp0`T:(K@0>3@1># R@004P  P I0@000 U4P0F>SP`1`>SP1>3"SPE P0Y 0P  p~`;>S@04  E0@nP0 gZ4`p 0YWP P 0 pJ` S S S`p0TH:(KS  G>S?R ` >S G?R `0 p`SYhG-RM,@0 lD`Fq>SU; U DU UZ UeT !(PS P  ЍUu  U T&UG UMpŸ TUE P  S U U U4p P>P PP U "U U p P>P PpAPPYPU B V \ TU  "Up P>P PPpQ >S U PUX }PPY P \o T >RŒP bpP>s Wp >SpPQ> Xp o -L4M@ 4 < 0 40 D #(0 8 Qp @XL~0A/4 00 0 000 W Y 804# 03   _Y RP T "80   _@DOoRB  R 2U  Y  _Y RQA_EPEU|"0@00\0#Rp R0 Rk R@m R R0  H0@0 Z0P0 Pp0PT:(K@>3@1># R@  I0@000 Z 0E P> P >1>3"SH0 Y00  p~P=>R@0  H0@j0 cZ0P0@ @@p 0TWP P000@ 0pHP R R R~Pp0TF:(KR  G>32P > G? P0 pPRWe -LMϟ` ^ 0 x   l?  R(000   0  Pl 0 $S000 0 0 0 0h |0 h0| S<Qp  S*t ` @pB`YpGP PR@@ W:p=BPt`|0U P0lp`0 h0吀T0 |0d X` P0 \P HP WP@@  `0 00 p ` <@ 8 4` D \{0 { A? d 0@ 0@d   pt0l0 0t I U" 8-x0   _UPW  _UPPU <TI  X  _X RQ>AOD@DTj|0h@  C/oQ" R :Pd   Std p Ntd  0t h YPh0P d`Rp Ah Pl00 Ul0 R  Uh @p X2  Xr W9;T Xa +x0 _XQT  UtK   00 (KS0 w00 0X< Rh " X* @pCl p t` `YpGP PR@@ RhDAPlpt`0S 0T*\0 H0 @0 <0 80 40 0 0|` x d X` T P 0 0 90 :0 p A?p  t  0 x 0h0 0l 0|0 0 0 0 J W @P V{  V Ud9T V  |00000_V0S  W0I  |0 0000_WppW 8T  V |0_ V00 0S RAOD@DTg00S l0A0 0xtp0l X`lRh00 Wh0 p0@@x V  V | 000_WQ  V00 !1v0h` |0 10 00 #00  00 p00 p0p'00TP UTG WUDG p ` xpt` 0 iPUp`d  60 TpWF td` 0 pW@@ XN  XL` 0pW\F UCi0S.p03 !/ 00-SL@P* 1ƒ!#S 0S 004000000 gyPP0 0-LM0@SP0S* P  QK0 P 0  -LMP `0 0:R00 40 ):q 210S. %yP) pyP 0 W 0\ .#2\D Bvp00 塡*) rBpp0` V< 0 0 Xn P&  Pn P X :Q 9 000(K0^S D  ]S -S-00p-p0-00H )  8 )  @ S* ]P3 R3#-PQ\ -P] [PR:0 `S! 0!*-Q 0    0 S H :R? =R0S0:0((S0 00  0-S]S0S007000= 0000HSE* V =R~ 0S00 ` 00]S 0S 00X}:08S000]S-S0S00vfp`| mP 0S `V0S000S000S    000S`0S* p@7P  I 0 0pCq0S q 0SP 0S 00HS* V :R ]R00  ]R-R 4@ 0&   0V0F|CzR  ]R -\ V0S 008000\0<00 -0 0-00-000 S 2* 0]SQ0$  SJ4p0c  c ^ ` Br0C0D R! 0SJ   ` ` @ 0S * <00 " 00 00 0C00SQ p 0<b  pRWB00  0R(Ko^`2000(K 000(K,0S 002000(K]0p]p0]00H  V 0D   ]R}  0 R:3Y0T A/o" R S `p   Q  \ SY@0000 00 DB"(Ko1_7 )w0 0D RFSC|4Y Y L@<D L,]$V hd||@ -L M@  1 `0P8p(0  0 0  0S 4040( 0R  K t  0U ] 0,Kp*K,PK+ K*0Kp  0pP@h -pRL@P`P 0!*l0pp -PL@`  aH0DP"%T R!0@B @@!W 0` -@p`LMP0 S 00$K0SV 1 V00U U0SzvNMLutsrq#mlkjihp`F0`FPEp  B0  B$Kk*`0 F  B0 SP "0SC   PPEp`  B0` 0~  B0 PS "0SA  $Kkp$K \0 000$K  B A   B 8u -L4M욟: 0 RL0 0@`00 y0 Sv 0T0 0<0 :8 0P0 H p唚P0 Sz*|Q Qu $LXP2"0/.,)(&%$#"!      y^, 00L00 0R/(K0S008000( 0S:U0S008000<0S0S 80 E Q*4(H00000 Z 8 000  0(,(, R*A?QP{Q P>Q:0S00|700000 0 0D @ G 40K010K0 740 @D  00S 006000Q:0S006000 D0 Z 0DQ 0 S*0)S T ) Z 0! Q*00)QL 0PS005000E k 0(0(0 tZ 0 0Z0 0S 00l5+Q000 :?Q {Q D%P 0+Q ?Q {Q>0 S*,Q 00 S *0}Q0$0}Q R00S 00P 0m*Q0 S  B0 S  B0 RPV*A?QP {QORLHC 0PS 0 009P*hß@ H @ Z 0Ss L3000 0 U < 0R0p 0S8p Q 80 E0S0H80 2 "0<0 0 S]  B0 SO "0SB  0 0 S/  B|0 } u0  H B*Qn0 S\  B0 T g 08p P0S 00:  B0  A   B   B0   B0 *>0000 E P H000< @ @ 0RQ XD kPttTt|rlr@rq0q^ ]pTpoonlpji -L4M⤗ǟ  S8 < 0 @h Re  `ZD` U:L 0H0 D7Dw0 YP@0 pC0 S~* R 0P\U 7U L.U [U JU D0 ZD 0a 0 S: 0!  Z*0Y20`S00pp$PE_oR YU@D0S 0S005000 00800 0Rm(K5U} N>E0CSM x 0JR 0S0050000H Y 0*Q= Y\Q `0P\U0@ S000  P4\Ux0S  < Ri*UP0S 4 000P4U 0S 0R  B0 S  B0Y  BP`h 0S 00W0  % 40K010K04  0 S-*R \R0)S H0) \ Z d0{Sk/0 S*,P 0PP$ Z*0Y\Q Y  S\R` 00Y0S 00H2P000`^Q @0 w `(,,( @01P0000\S0)S  B0 G Mx  D`F `;0(0  (0 }R Y0S 00Q 0L0000#R ,RLP "R>310>#R R@0P`@RP (pp(p 0>3S S0Q>31S B R R R SRdD `1C Lp(p @ 0 81 00 0 A(KR(D 0L @ 0000 0  V(p@` @X P<@ 0>#R0P00L @ 0P(K& Sh_Ee0]\ -LM K -!MLM@<1<0pnK`FP@ 10 8KᒂP 0 0 R6(K腮KJ  k,0K0# T PH [P\HT PCK|H04TK 0PP 0eP0iP @T\Hp\miRPl -L!MP1!0A@P t1( 0K`p6PCPノKP 81*P7$0K 0#D @ < 8 4 L( .KHX PX P%THT PBnKp `F0,TK 0PP0PhP @TTH0S h & T( 0R $KT,$00$QP4Z 3 XX -GMLM ğ  ` 4 0V0 4 @U F^K PE 0EFK0C.K;A5pPx4S 0E PT 0 Pl40MPPt[p$P~PypOTp hPplFhDMP p<T h8 Xt40 0R(Kxb`x4PSPX/hP*hPx4$`0S b`/0 "P4 1 i/PppT  =PZ0 Z"0$ 0 $|1 x!P0 m1PLL<x444 3 4 !0P4 M10$ 0 $0 P0 >1 ~pibxxPOP1 1 D& $& 0 1 $1 $1 0 0 0 t0 / p0 p0 80 80 T/ / K 0CG~KCK$ 4 pGI pPP#  Poi00S+ i0=S0`S(X  V``V `ሀ\xDi0#S@ @T P40 0R(Kt40Ct4 i0 P44K00 @4 P$i P0 @44K00 3 P |3 cm}# ^a# Xat4$0CRt4 e  0pPp4 lCnKP# `Ft4 ]d @dT0D00lT dt 8i Pھ0 4CK@CI .(Z34[$SX SV dd dd dd  Pfp$[R&M 4GNKt4 x4P@h,|$0  0p4[ S  P t4S P 0  p`  ~P᳛ Pᯛ P|4h0S 4xh|\t pIP- - , Hl+ + p+ XE hP ) <) ( ( l ( ( -LdMP !px!P@K8`#8 x 0 j  0d l0 ` \ X T t0Kp Kh p pP3t0Q @,@K@.`@P 0S t0 @t儃x00 0R(Kl[0  @@a 0|@dBP`= @K' ' 0' p -@ML@K -LTM44A4` !p!P@K8P#8 0  0d l0 ` \ X T t0Kp Kh p PtQ @,@L@_t@0 @t0 0R (K@ ({@@P\; @I -@ML@K  -LM+Kß̢ 2 0 p2 " 0 p0nK2 -0P VPW 1[ S S S| S ``# @ Sq S  000 S S S Sb  R 1[R@+S1 -SlQ[U: @U2S  Q+ 2 0_o2 0`+SR%0S* @Sa2"PP r  PpQ[U @UO2SrQcP̂Ȃ 0+S -S/ dPPUxpx? XPr;@0 S S@0 S S C0SR 0 C0SQ ^_oR0S @S2"fPP`  C_o`R20 0R(KcPP2 B0_o2 R@C| $?Ph -MLMB@  0 0 R 9  PJ K A0A0C.K;!PU9SR NK +H^+QPpc9` 9 i9DP@ #=K 0C9 P-8: S1 @|1 )0090 0RJ(K88`P 0 @P 100S@0 )0@0}rP 8S ) S 0 )0@00 )0@08 d0 )0@00 J@.:Px$ $  H$ ( D    -L4MD@KP`p me H0K< ؁PH@T@T 0 !PPH KH@P KP\ 0-L(M!^dd@0 @0$ 0  (KKKKKKRK 0RK0@7P 0-L(M!^``@0 @0$ 0  (KKKKKKRK 0RK06P -`@ FLPdp 0 ` 00A ^aAPWAAAP7AQ0 S A@P 0 R:0Bp BS 0ą0S  0R:0B00 00 0-q@pP?0@XL`P ?XD? z]0ST?02:4T!2*0qa p `R?p??` S*"" P* U Q*.  0RS* U |00?0Q*00@0 3 0R ? S*: 0 T!:CChCdC`C | B -`p@@@0@PL,00 ;@ 3 0-LM @@0P ( @PP dK0A -L,M 0K00K 0h0K0$0K0, K(0K7P <,@($ K@ 0K \A -L4M0K 00K0@ 0Kp0$0K 0, K(0K7P $K00,( Kd 0  -L\M!` P0@h P DK !@  @ 0 p` lPPO @T1Tq0pd0 0   c@P7 `P%TKPP0K0X0K0T`0 dP LKXP X]P0SXlh00 0R(KLK  pP  )PSc001Pl X T H @ -LKM1!00pL1 000 _hdqPPN @L1La0`H1 0   @P6 k`P%OK+PN?K0=K0< 0 H]PM/K@8 @81SL10 0R(KMK P 9`Pc00s/P    0/< 0-L M0 0@PQ00  (K⽍0|)K  0 ""C C^0 0 0R K00 !PP0:<-P -FML M@0 0pmK0(0 K PPBNK@DP+ Pʈ$ b@b$@R( 0R Kl,P -LdMp`T0T0 P@K0(0  {( 0R K|+P44 0-D@L@M@PK %dZ 0K0: 00`( "4`43MSZ!R Ѝ/ p-L$M0 0P`Q0 0  4@Ky0x( 0 ""C C^0(0 0R Kp8 )e`P8h*PH -ML M@` }K pG( , 0 `P70C X04+0R0# T @CK P  T0@T_0a@a@,(50 0R"(K+a@aX@ 0 YP0QNK @DD9p F)P 0-LM K -LdMp`T0T0 P@K0(0  >( 0R K'P -LM@?00@ 0 0pK00 Z  ppl *g'?eaP  .P @ iH)gt.P$D],L d nQi$@b")b) h*̠ ` (Р! xp `t!&|p 썈`@ lA|p% pj*\.`,Ġ `hqj,$a!  X )` (naTa)P-P'ࠐ P@Xj*,Ġ bQ!.i, &`A h(j.% "p L,Ġp`a!.ht,` $Haa *Lp Dp` P,n*("  agX'`(@* &%T@匀 \a g%) jH*$D ` @L`$aq ! %0"Q0 ?P0%0?SL`@@e TPePU*K0W@@pG $KklT -LM 1P0@`0)K 0 R001 13R0 0~? S pp 0~? S (KV `F0"01 13R0 0RK8P p-L$M0 0P`Q0 0  4@K0x( 0 ""C C^0(0 0R Kp8 )`P8P -QMLM@` I~KpG0 4 0 $`P70C X04+0R0# T @CK  P  T0@T_0[@[@4050 0R"(K+[@[X@ 0 RP0RNK @Ddp GIA<P 0-LM K -LlMp`T0T0 P@K0(0  >( 0R K` P 0-!$$$$ $0 0#EgܺvT2 -@LtM@ lK;S 0l `* `&i{@ `h@j *t  "jdP | b)&,`Pfkȇ" .\@b+nP,P%X@lˠP] .`@!n@T`dL% !P` X`e[bhp 吐 $ 0l| `dK ` L !, 0#t0cpmvmzNS  $Dp " 0pl0eYpx0`pl0m4n6*=30艄@X0 +>Cp3C(7C0!H0pb+>C 3C7C0 0a{ 0ᄠ i` `&@Ixp p`k ` $a\,`P+A0AA80e[m46*=30ꬉ <0+>C3Ca7C0 d0hL p`p'+>CdK 3C` 靅 P7C*0 " . `;Pxp T)0 0bpjX0 )p \p (i 0荄0 @%@a @$@0 hpe[ pdL p(pp' p`h `z `$``& `@dK fiP'.0Pg{ PnP&lPP%fkP e]@.nX0( @ dIp %D0 .p+>C4x3C7C+N0N∀0Nc:< "e[ g}`$``&h`-d dK k 'aa. 8g{ nP&PP%PHfk [@.@@$@Pn dJp%pp'pDe[ }`$``&`4dK h' <,g{l̅P&c; P%Pb x 0fke\ ,@. "`@0倀 )LPE刐 lˠ!D@ %.p@pb@ ጥi 0 "g \px0e[*@ `@$b{@`` hpK0! p#0 p0 a;Xgz$P,dKLP'` `,g{P`fi! 0aT0c=&@P dfkPe\# pc;8py% e[4a'`,g{l @!0f$T@i`@ 0`aȅ@ Px @$ `@0P` 0# HI0 `P,pP%c<Pp@ " lg8pZ-x t|``lˠ᐀) p$`p'xpP cˌdK0@ pipp (K -`p!!?P@eZL@U@@ @ L@eB PT @PT(  G,KoxL@0@0SP -LM`@ 0 P?@ n##|(0K#4R &K!̠!'0K$K!4 n"K B!K#0K%pK (KT 0F ", S "$   0R` KhAS@P, Q() 00 R3) xB@-d W@4  R  *4 8/ḯ t0 S@- d;@ 4 *8 R РS /+BxB/00!8 /Q//0  0c <c -pLM,@K4`K $ P0pp4 0 <pQ pp0,4 8 0 <pD pp 0,4 8 0 ;p7 pp 0,4 8 0 ;p% 80S0C  BRS 1 ! 0S*̠p0+4p 0 8 ;p`(KR0 Ss -ML M00 Pp0@.K(0 'nKp`F  JP"#3( 0R! KK AEp nK`FPT {JT"(@D@0*4|RPHtH$ 0-0@L@+PP0hR@P -LlMS 00 00//PP p-LM4@K` P)PV0E>S 0!31 00 0  Kp>SH 0!31 00 0 Q00Q00/ -p-L M^P@U0@ ` ` P t0t 08 R;0Kp a 0 \( ( ex tx^ @-XQ -Q =QR-@+@R +QoQ uQ gQR   +S -S =S000@"    000000 0@-0P AXS@ oS; uS6 gS 0+S -S00PXST 0! 0P \PSPQP\     0 !#  I@ -LLM@wTPp 0<`K LKL0 H0 D0 @0 @ ~@`P 600000$X0 0 \ 0`` pa0HS  v'}pC~p `+X@ 0-Sa=XX00X0 0|PXA@ Q񏐀~}|{zyxwvutsrq%onmlkjigf aII00W  |<W  ;I?S R:``Q h0 d P d PE Bh0`  \  =Xl +0H?oY20S Rv*W\00 X00 R:``Q d P d PE B`  \0T0 00 wS8X!=XQ X R:``A h d0 sP` h @D Bd0`  \ a Y R*W\X0 0 X^ ,X4`P =XXX 0X0 ``Ad >P+ d @D B`  ``Q d .P d PE B`  xnO 0PK  5P0@0SmaO0"S1Ds `` YO@`UO0@`0 `(K>0SV-+`` h!` @0 (K`X` p+P-@ +0B XR R p0+R XR  -Rpp p X0@PPQ`N00N0`@ 0`` N0`` 0  0-L M K  7p` K P-L 0 No`/00/00/00/ 00// ///00/ // / -@LPpe'=`+#=V Pe 0 000P@P P`rbP T000 p@000[NP][UNP   -L@r\P` O0p0D80p0 `@@0p05 0-0@LTP` '@T0rS PKhP0+SKhp -L0K$M #, K_D!0P $0 ( J 0100SBp@$ P C 0$K0( 00S.$00Kn K @,0 /0M@Bh0( 00S dS$`M0@K,D$0\f, $  ee -L$MK 0,, 0 K 4 !0P $0 ( A 100S4^p P 0$K'0( 00S($00K K;4 0,ecM|0( @00S d$ZXRM0@K, $0LdLdRxzQ K @   B  0Qv R r ``Q=K 0C |P?**[!-]p5 @ -LMMnKQpP  0PPP@PPP0S @ }R& R [R {R R  c(K @]RR^ @ ]^^ ]^^ QAP?{S }SQAY  B0S088  388 T#:0 [S ,SQY 0 E S:    0 S]S S  T*00(K0]SS -LM 0` Pp 0S0 0%0{S @(K S 0{S@p0 DP 0 }R R  K( KE 0 -LNKM @DM0  ^K     pk \\ \ɌRB \  KP \K\@ -`LP@PTQ@D PEP@DP t 0000 S [S \S ]SP/0S/*S ?S/Q0 S 00 0@-@@0 S0 #S3 C SP0 S "S@$ T\S 000S \000"SP @0@0 CR S 00000 -QMLM 1 ! A0P@ Q`  } 0R/K Q~K pG G0K R~K#  -p x pB~K0 \P@00  0렴P@0 T -LM5u0$pP 9500S U0KP#S#+{D0 0 0 P@$f 0S h%` @ 0S @#S (u1PKp " 0@S0 0 40  0Sn ԔtԄԤ p 0 S 0 "#0S $ 0000@SN  <P  <P0 S 0 "#0S $ 000DP}(K ;P0 S 0 "#0S # 000 ;P)0 S 0 "#0S P# 00010[#S 030@ R d20Pg  (K0 S S ;P0 S 0 "#0S " 000x ;P p ~;P;0 S 0 "#0S1 0" 000Zx(K0 S 0 "#0S ! 0@00CPd60@S0 /@(K| ;;P0 S 0 "#0S  7Xpg  02c11 崐  0   K @  0S A0 K0 $p P@4B<00@K PYrr0[ [CQ0#R l0[CQ0#R k0[CQ0#Rz f0[CQ0#Rs i0[CQ0#Rl j0[CQ0#RE s0[CQ0#R' t0[CQ0#R  u0[CQ0#RD p0[CQ0#RF o0[CQ0#R n0[CQ0#R5 m0[CQ0#R. x0[CQ0#R w0[CQ 0#R v0[CQ 0#R00K0 SG:X< 00[S R|  B :0S0 < m [RO`@@`0S A0 0K띐[AT 0 l0S zA00K{@[tA@0 #P pᨐ 0[  00K  P   430000K      20000K 00[S  @V 9 " 00   [@1hh p / 0,PK0 h%q, ἐ @$ 0S~A00K@[A@f pm ,pP= ;0  [T0P P 0 0 PK>    [>@`B@0p0D0`00 2 0S@C. ` `@`F v0` [0 ;`0 0 @@Y0`0`00C0  t [@` @`@`P В $ h@0 @ 0-LˠM0 K 0-LM@P@Q  0ˠ0P K0Fjp,K0 P l -@L@0pS`"@@Q%PPR @oP  p 12c1NS@*   p p 4 -`L`x@ᩭp0@P@T \0\0 R@@8P00Ꭽl/@d 4/ -pLp`@P} @0@0S @@u; R"@dk᤮@@sP00?@X.d\l. -L?0 00ȟd -`HLMP 3pP- 0S 0V "  U(K 0KM0P$0  R@㰁Y&jS 0 ㈁ 0R 0Q dXSXTSHHNS 0@0(  ZG B&R/&hFXKHA8 ܪ T H4d ć 0 d l  ة  T -BMLM 4ܔ0ğ       0L D4 0H 0 @4 +0DpkP08 4H0 4)P BnKCNK `F@D\ @4P 0S 400#S @T\ $P 0S 3S0PP\ P 0S 3S0PP\ P 0S t30  \ 0P 0S q<30\ 0P 0S rq 303@F0r +,`K[6pD& \ @P 0S 9PZ PZ c;Px" p Z;Pe TT2TT0 $5RZ 00?^0 ^; *^ 0 0Q?^ 2^& *^T T 00 0 *Q .W Q1 /Q 80S ^+P ?^ ^<0 /W (K[^ \^40S T0 [^W /W TL ^^!^00 PP T X0  ` 04P/S \S U T0  00Sy -R Y`T0  Რ00]SVX0L SPPPT] pe fT ``ᶠ``]Q``V \Q 9 Y YW= /WZ .W D0S @0Y3 80S 0Y/S- [^ \^+40Ss 0 000000 0 0mUT  `(KLPPT\^ *^ 80STB 80S0S40D0S @0Y 80S 0Y/S(K H0TpC<0`040 00 0  0 P/Z T00 40S <0  /+*ꌕh@0c P0-L@ P ~;0@00Q 0Q o@a0`x Dx 0-@lLPt80PT  0@i80PT   0K; 0 x w -LMp0!@  H"  0 8 p@\ P  H20 0R](KVPU 0 8pD J  JP; D2S;P<2 #nK<<2P P+ < 0 8p! 0 @ P@D2PU*@ <a 00,0K 08Lp@:@-@T@@DB @P -LMp0!@  H"  0 8 qp@\ P U SH20 0R](KPU 0 8VpD J  P; D2S;P<2 #nK<<2P 5P+ < 0 8Ap! 0 @& P@D2PU*@ <00,0K 08Lp@N:@-@T@@DB @P -LMp0!@  H"  0 8 p@\ P  H20 0R](KNPU 0 8pD J  BP; D2S;P<2 #nK<<2P P+ < 0 8p! 0 @ P@D2PU*@ <Y00,0K 08Lp@9@-@T@@DB @P -`P@@L@PP bPPK:KK2 K@LpKD`K"P XR  H K@Kp  D H3DX4K sp  D) P [R D% 0qY@-  X3K7K;K?KCK\p   L X8KRpP <K X Kp X ` XGP T?DT 0@1q00p`H#(Ẉ4K\pB K XC@K&p0@P0@5T0TAT1@X00d00 0R(KX00X0 Xp 0%[0 0fA܃PܣDtl \l (l l l f TN k `k =8;8%60 00K80`Sp" 00S 0S60"S !# 0 r1WV0(K0 VQP05 0 (K5" 0 Dzh  0-@PL/ 0S v1@T0)0qT& /S T'*0Q/S$ 0 AR! R B/P@Ct0@T@!@`\P;P )0008@/S@$@@C(  L 00-@PL@M4 KD TKL0 @0 <0 EKp K0S K0 -L`Pp@ Pp! V U h Np` -*'VW@!@b  C- 0: Q?o?o 0@c\Ll @L,$% \* \ `2 pf0C22 P@@L8$ d PP:L949 P(! /@@ P$!/! .C-@P0 M /$P!Qoooo `@f\L ЀlLDE Ѝ\, \ p7 h7 Ѐ@ P`F7P@PP@L d8d`:L9`9t```P&p@(A OdA N@C-`p0 M O&P'0 Q0oooo `@f5\L 5l `L l246A Ѝ6\/ 7\ p77 h 7Ѐ 0`7 00  70L c8c`WL9`9s```0&  0`Av "0ᢁ  0 A-pP`':?C0CS?S%@P3S`v4CNT0C n0Q" ::?C0CS?S 40c @c0 C773#$ P@-;0SJ?S@SC70CC a0A$# 00SJ?S @0c03 " P-L ` Khþ300 -`L@P DP 0-PL@ DP0 -`L@PD DP 0-L@PP 0P 0 -L8M0Q  $00 K0 K=<;:9876543210/.-,+*)(i&%$#"! \7,K 0! 7\80@ v>C 0C@< 0 0D @ 080h kW@< y D0@0  ]W@< k50 8K0@< aU0V08H0  ,K ! 0"80@ 0C@< 0 NWL@` 0 0@ S< @0pW=@ 0<  ,K !8680@ 0CW@< 0)W% W  0,K 0! c080L 111v>C 0CR@< 80 @ l%/"b!!!L080 @ 00L0 tc0 8KL0@S< @0ş08  ?2c11180 @ 0D0 00 8K@80$/A!b!b0C@ <@ 0\ 0 #K000C S!0<0 0 B?#KKa 0`p<cK< 0A ?\#K 0A QR0`<` =0 @W@0 X@<  < TQ <@ \ @Q 0\ "#  R z F/o@"<K{PzzVEbX p8 Q:\ ``2QX0@ S0a$ 0(0XX < MQQ @ <2@0 @ $ (0@  /#b!!"N0 K/ ϠlR3l11R00@  10 1 B000 80DSd080 ApALA P^UJQu@1@0< 0@ 0c$0(a@4K Pk <@Y@<@ @< R0L8 Ql 000\Qm QXH!2gqqq@;W8p Nd< >p!]xTjQS PR $IP l'nM L J QXH l^@APN0A S@0Ma$0a@a$< @(0QQ p@F< CQ<8< < `s @ R @ R 00@ 08pK00P C0P  8<0 B P@@0($   <T .0P  Π8<0 BP@@0$ ( ! <pP @8 1 0!0( 0c$0< @ 0 0 0rX p-L4M@00P0` 0 LKD00D0 L KQ Q Q -00 0RKp@(0# pXPt,t,t,0@P/ P @/ -`LVpP! ()@0JS  R@ D0JU R  RS0@0D@R B/0S00  Br/\R/0 0R/ -L M0 W!XPDqPpF Z"PA   !p`A (!@ 1q@W40  00SO"0(K0 m!P0 0 P!@P 0 4`P 3!0 @ %=   %0, 0 "0VL -fML Ma`   Pp0 R зpK 00CSN K AAp? 6: S8@GKY>K 0C @5 D D HOu_^K5PETAXA\A?; 5 5 C>KE 5 5 pU  0 E E -@PP 60 0R(K,O00@,0@0~,0@0TP- 0   R --L M0 0 N K -- LM 0   K -LMRp@` R00?te00P @ P 00 P! !  3x1WP5 0 K4KXVP Y409 V[WP0P`0 0`f`0` 0 00 (K4`0P% 0P0WP C0PP 00 (K80 P80 V  P80`8R\T -@LM(0S1 0 +PP 0(1/0 QP`p0&  00 0`VS <0`VyK 0S  0C`eg+0`p0^ -@LML(0S< 0 1PP 0(1/0 QP`p00  00 0`VS <0`V00 QPK 0S  0C`e7+T0`00+0`0 ` 0 0-RL0 @T0l0 R00 0R0 P P <P K0heE -`4@L@(P喘$0PbXKh荘dL 0-0@L@$P傘 0P[XK0hzL 0-8@L@,Po(0PfYPg0XLA-M t1t!00`00S0P  P XQP 0pS  U8 CR8$0D0 pS "X 0^ #R ЍU   "X ^ #R.S A a  00Cp0@  NN!RR 00RL4  R  *4 8/L  0X\S 040:8 R РS /xB -Lp`P L0L0@D尀 W  ᗾ MhᥩIH81 -LP`@ *0 YA-PtH @ \ -+*)("!%$`\ mJ rOv ?Q00000 %\@ 7010pS;^ cThǟh @dT 1U QQ00^^70A00-Q ^Q0000  00N00W0C0 0#Š,\Q @\0@0%Ao 00&Ao  00=Ao#4~ 00z00NSP0<00C0o50000 I G G70N3th$4 hgH`g=fL - bp` LPPg !#3b!b GaAVJ 0S$ RQ 100S 1003/P.!@0$p 㾧0U0Nl100SO\10 0SD 3/D!V 000(ɿ$10`03/P, V@ @$p s00  0S00 0S00SU@0S P0 @0V@H  000400hf f1 e$pedxhd -`PLPy !pPv A@Pd  00 Qc,1咃)12a10BqAW% X 0#PXT $00\! 0S7 <1003/P0 0 $000! 0S 000S0 3/ W 000(Pp0003/P 00000S000S TP0000c/>3Xcbtb = -`PLPx O!pPu A@ Pc  00 Qc,1咃3a1a0BqAW% X "PXT $00\! 0S7 p<1003/P0 0 $000! 0S 00 0S0 3/ W 000(㏾Pp0003/P 0000 0S00$0S 㑿P 0$000a a`<` SR-Lp`P4 000S 3/0Y @IOP T 00 00 Y @IOP T L00 @ @0 0p`P `_,__^^\ SR-Lp`P5 000S 3/00 Y @IP r T 00 00  Y @IP _ T L00 @ @0 0$ p`P@^^]]]8 -PPL@ Q {PPp`L@7P lP`V x$0p"S !o$0P0P -ML M@P` Q08  QL /QH P.00F PP:p᠂x /Q1 Qs P P /RR.Q4  J   BRm/0  I0 P@E#K Ap@ (: S( )S /Q Rn/Q @@P $00崿`(KIQ .PQ V 0z/S @0W8 <8^Ku PE@ ɮP4    P/  r8/Q0#8 x V/0 P00P0(K#?0 V0/0 P00P0 `P h U#>00#00#?00#00#0`0 -0Q@PLP6 60a`0ļP9 0 0\0 @:\0 S \S 0@ S @ 0:S@ 0L0P 04  O# 0 x/tYXX@-0P:P\\ :R^0@S@0\\:R\@^ :R^:^ 00/0@-A@\  \:^|^00^^ R B|S0 0:SS  -ML Mpǟp @d l !Th P$ H4 0 X z T 0G@`V 0PT4 v  `PB P4{0S T$ &CK \$ HP0 00 @ 0SP @ R X1 :RF \R R R \ +*S `+ HwP @ 0 R@X+Z`* #RR XL4 hPL4, `:RZ `\ :pG{L4 `LPL4 pPF`@ ∻PP ᷑``{ 500SL4 C 0L4 4\T 0`4 = `P6  :S 0PS 0CK00H4P$K@8PN pPI pH:00e0L4 \$ %0 00 PP40PH4 &0T4 L\TT4S~Fl$0AV0k:h4Pd40 0LR(KT$0R L HL4SNZ0 0`H4 P$0SP$ 0L4 L 80:R@ @ R@DI 00SH:S:0E 0 I0GZ 0 FX4  X48PC `[l00Pw\4pG p{V\4P`FHPE4 \ p`P!@?!@0L4 ?PP3! 0 L$ 0H偬}(T4S u! 00T4@S Hq\LD rHkT4S Hc80L4 c@X4C~K@4 pG< ]K `0 6/p P0L4 03/H0L4 8`V44@ 0C<4 p cPP03/ꁽB g03/Pl4p0F?o2L4 h4P!@ὼ !0@L4 ,PV! x 0-LM  0K K 0-<@L@ P 0 0 00   0ON -ML MS3P0x#xC @8 0@00 0 ^SD 8 @3@C@@c@s0@ H8 `pP  R& KA P$ 8( B8Q " "# :\ #\ R&  P\Rw  P  R080 P آP  I P ၢP C R  R\R   QeCNKpQnKP`F0S6\S4 00S0 :S: 0 088 SK04[KS AH |S:SH  A:S|S 00S 0 ADI0S!@800 Q/(K h P 880pC H8 ^ 0S g`P ``0pP = A.KV$PN|N@NKD D4 ;/0D$, K <$4I H,0K0$Co0100M `@@ t0@d 0D4 CKDd0S:SD4V F0H000D4 P'   $ S ,  R 0 00 L -0-L M0 @ 0R 0 0 0P0U100M 0 0 R   R ,00 娨 0RK0XPL 40-LN @@z0 A -L4MŸ P`p 0 崋l20 RA dKD0K<@KH0K0L0K 㴃KOPH YL0 P0 b@PP0 I 0 L0 P0 T H -P0 I PH  X100s !&$RG 100S @0 0RR(K X0sL P 410P0 %P9 5SX"WV00#  @ P0PT0  0ST0@ T R"@3:  |0 &ft0`p 00 ` 0S"@@@ ;8Pt(Ad@@@ < 8 ;-,@ M@L@00:PK> -QL4M@ 0 $0  " , 0 0 ( ,KT D KP00@0#D  K K 0-L M K, ,K(0 $0 0 nP K 0-L M K, ,K(0 $0 0 ]P K 0-LM K"0 0 0 J K i p0h -`LVP pP@PV 7P/ -LsM@ p` g?K|K0 1 @ @ ÉO0Qa a TA}oKXA\A0H  0 @0 0R(Kn,PP- 0   P -LMϟ@ p 0q3 0  1S01 `̓ Г $?03 ?03 P@U P0!%Uȃ  $ 0S0 R 30 0R,(K P0 P 0C `S303 @p0zSE8~}|{y(pniedbpJ 0 B0`p B CPO 303 @3 03 0SI3  @DT񏐦|K )Pq0 !P 0`0CS00003d0CS/K10PP[ c c# P M# +@MQ$"$ 3S03 3@P UK303 @903 ?K3 0 o3SPkU3P03 303 3S03 3@03 3S S @PEtP U0C @`3S03 3P03 63S3P@S  ,K003SS 00C003 0X0 0S >P U PQI 0#C  # 03`03 )  #S`L 00CS01000X3c cS XR    0#[#0#        #3 # #0C`X VM# hV h@ @@HVL`  M 0,K03SSo 0P 0CQ g S P U3S303 @s3@<3 03 l3@03 g303 #!000C3 @[ 0@3 W330903 0@3 K3;3 330;03 #3 # p# 0# `j#`f# #+`^ ` Y`W3@93 03 3@<03 03 3:3 v03 V3:3 o3@93 03 3;3 d0^S0 3 0# 3 ?K,@@3 3SpDj #S # P $  c ` !  # , K BC TpD-Rt ]RJ R 00 0 P 0C `S P @ P 1 P c 3cC 0D S(*0/K0Q# 3 3 @0C c `  s  APR+ E  P BR@  T 1*PNU \0U IU\ P BR Q *P@sW30S 30SWW00CSpP0s T:sc 3@DSS5*T T 3 #@Su 33P3 K ?30l000S 3#0CS3S 03 3`03 < P  8   @3830x 0PmWk*@P XR sWy ?P 0P0CS0 R00*@Ps *Pp 0@0CSP00T .*P03 p0ES3S  P} 0p0CSP0@03 3 `Fs0S񏐗\'P<p+0E rP 0P0CS0 X*pP _P @0P0CS0\/0AS00P0CS003 " PW*@P(U0P0CS0E P T *P0NSp0P0CS00@3 PS3~S P! 0p0CSP0@%03 3S 0P0CS@0 T0*PwiU nU3 sWT ]PO 0P0CS0 0R-*Ps @PAQ 9Re*P@ P BR @ X *PU P BR@ `T *Ps&0P0CS0pW 1*P@Sp P3U#0R0C SP00X :*pP@0P0CS0 u0R*P03 3S.p@cs3@ 03 wY04 K03 ?K3 0p3 U+3@PC 0 P #0C003 0X0 0S P 3 3 S @C xP 0 pP 0@ B0Q 0 R0@3 ps  [P30A0VP NPT*0pP CPT*pP)Un0P0CS060Q*P@pPS3s 03 03 @X8K03 _Kc spw0S6W8 aPJ 0C , K0 @oKLy 0p4 P p  ,0K3PS 3pGS303 3@03 P TcsSU 3S0303  3 P3 S0 0@00S0 3c 03 9s 03 _K`s3#S # pG0` R)W9 P ,0K B@  L 0Kឱp P p 3pGS303  tP Xcs3S303 C 0#ҖP0 3 `0C 3 3IU!d # OP#JRH*0 P CPT*Pl3p3 M 6PW*0P0@3 p5 0#" uP^ 0C , K0@?K 3 N 3 #p0F P p R6@bSP00X H*P@ P)X'* pP/ # P#)R'*@P PbT`* P, PX* P -_0U0P0SK0p0CSP0s <30_ K30WT< P,T**sP  PQ*P#]X p3 pP@@ T  p P P3# /303 0Wcs ɰ0P#U B`# 0O RPT*0P03 :c0cs3 # <P#7R5*33 P@" .PW* 0# P #PsXq*0@P%0c@s3 PxXv*0pP@ PT*P(csC @ csC @#S C# STs0c c @t t3S30C3 mTC #@t e3S:0@csC @QcsC @LcsC @Fcs @@cs @;-00cs@3 3csC @- @@pcsC @csC @@} -@P`pL60 VP7- 0   ` 2p-0LP@8 !00S7  0`v 1S010d B00PP0! pW@0P? ͭ`PP 0  00 @ C PC0000&  Q  Q* PR&  <0@08BP  P00`0 P ; BA@ ?#0@0 P( 0-@PL `uP0 -L@`pPᄯt0t0l尀 ሔT  @0 ϯ$ uH 4 ! 0V -SLDM@8 ``pĬ0PP0 J RP㼬0PX0  0S40 ( 9`0 @} VPP ʀ0@ `FVP T JP00P0PEEQ U P! `⋬0PT0 `0S` V 0T 0C BPT0  40 R  30 R 00 00 00 "00@\0000( xU4 P`XTPU/ 0 8/P0P0T唭X咭P吭 Ꭽ(K 0S V@PPňP  Ђ p T`s0X00Xk80L S 0\0 L0S 0H0 X04pC< TP @P CKDp @@1< C c18 K `PpK`RQ B 8@ P431D5>0 r@DpH0\ 0SFL p RL H0 P4p `0 TSR04 0 0@XP (KP80S 800Sa P40PaPT ]꤀G  R ' !0  R! ㈫P 4 4p HP @Xӭ0\0 iLPP> h ` -LK0C.Y 0($ !$ 0  100A@  08 P08 \  AL+\ -<+*)>'&%$#"4    p \Q d     QD P눢PK ,K 3 8J  HH0 * -PLM`@h \P ݡpd\? t 0S0l0  P PlP  P00l0 0K``  -R񏐸`gfedcP@0p0 `  R, 0R 00B S P @1T00PCT Њ 0B` @00B S0P p| EQ Wq  R `` h0S` hT0 T0P (K0p0 `0 0 0 ``0`0 0+Si -S0 0 0`0 00C Q`` 0S`|` 00S | 1CQ`0C0 ` 00C ^ |@ ` 00A0@C T@| @,QPPa00Rp0 x0XSU xSS ` 0R Rk0 |0T0A@W``0 z WKXʀ0ST0P hP`pQ Q (K0l0  R PZpPS R` T01 p| 0C P9`P0    |S | p  Qq0PS ЊR| pR W ЊЀ0`0 0`:01$CK  0KWKl0 `GS`p Rg S00l0 V0 K)1 0 K`'0|0 t0 00խ0P0 ;  R0b 00 ?0 l0t 00 oHX0 B@H8@D0 D `W00P| PS0S`FPEpG0SWVcʀ0SUW P] \b0Pt0 W P  PCl0Sx P2 tʭ h8`pBP@P@HX'78Pf|0S P 080jSk&PBTK  0kX 0 PPL KEK\1 / -t+@ܹP   ! K@0KH K⯼P\  㾺P H0|S  `Bl `R@ 0C0̆0CppS6 bd0@0 l@Kp0@0l\0KX K@K`K4 咪0@ ShT0QP `60 P @0S ` 0 0S 1CQp|p  I0C%Sze ZE0"S3p0 SP0!1P0 85K00 ἵKMV&bVK 51` ᪵ VRXP0!56CP0 K ᝵4t$0SK&BS4 P0 05T P |0 l0S0l0 $`@KP `00(S 3T P0 `@KլP `00C`0 ̬ P`0T 0`0 3P0 p00C`0 0|0 倀 0QP B 5P \ҹP \V\ \屺P\  ptl0S H3T P0 0S \  "00T0P  P Uw ሺPrP tP 1`pɫPt XP@ X2Tr)KP dR2`V. | jV00R0S @!1嬫P  PP p X}00 10 +K)K0k60C0 TKIK2 0Ѵ 0KᱴKP@1| 0SRdP먱 0᭴X`p8T0S5DFT1 0iPJ p\tzx vt r;KᎴK9 pሠ V 0吴X p1 0 *KP@)KL$NAX |  ? |(5?55?P9?1࿬0s pt ,0T P0 "00 s `f0 K 1 0 fKFf Y,0|0 ~YyK0``` 90㩐`S|0Sg P 1":k0cS S4ST 76 0C3P0 K0#P9 0%KTq0  0)KP0S0 KIK\ HPKR 5j\Ʒ0X TKT0Sz46S6 ,2ᝪP<2 ڳp1 0 ,K)K0 *KD5FDTK%KP@ *K$ 0 Kij%Kᦳ 0PU%K*K@PKKX"SO 2T P0 N 2 s)K00 sp0T SP01T#0 0c10 ᱴK %0gSp0pgSP01P0 3KP1 ᅳ00C1 ဳK#35P#30P ST pt 0%K00 +KP @tx5FP@ pt`0S0Sl0S V @T|0STK 0A 0K!K\   |0S K50 00 +K( P@0QEK"00L5r D5嘀 ,Khu;`P tV pt唀0o S \v  V|TKt 2X ptT0SP 46S50kS0S0S P ᏸPP ş|0S<60v kSt7Si\夶ᢶ ᠶ垶 ᜶0|0 j0Y|0 ~ʏ@ KBP<<0@ 46P0 T OVsT0@SV_P 46SZ|0?o2jQ0SE070jSk&PBNST0ST 3T0 kT0L :2 0Ku 0KᆛP?|0TS 70jS#:k0c3Qh7Rq 006T P0 %P 6C#: :T P0 0 · P@`XKK 0 0  -L(M8180 0@SP`- P P? Pp  p0K0$p 00 K80K0`40K" P 00CS  01Kp  80804 45 ;0" ,0 K 0pȠ$   0 0 lP0-`p!AQJ\ @@P3\4l 0 l2V L7A5 //0Q/0S/S/0@-PP0@ S 0\\0 00@^] -p BW"RL$M @ D @y P@SP-T`R +T@P00T{ Wp ? K K 00"`KpDK #K0#4 0K00C Ra CRWCA CR7C V^#KKQP00\00S 0#K0P@D0 D0PK^00S pZ 0E@0 @00(KZ ^ 0Z0 @00(K0 #K 0$K p00XS00 C R A BRWw(KWp 2#K 0$Kpv @2#K 0P$Kpkꙙ 0 0 00- -pL$M BW"RH H P@P-T`k +T@P00T W  ?X#K#K#KKKPOKQP00 T00SEK4 `00 42"< R0K@00D  R@a0DSW@DA0DS97@DW6v $KKXR%KQP00 T00SK4 400 `2"< 0KP@"0 01`#K"0 01`#KZK V0EH0 H00(K0Z0& H00(K 0 p#KXs #K*#K%Kiq00XS00 C R @ 0P#Kp(K A BRWI 0p#K ?? K 0 0 0D -LM@P`{p $KUT 0S*$#P   K@dpK%S \T@p@$K@! PpKK@ -L M 0K$̒ @4/@P 9@K 0 0  -LM0$̓0P K $@ 4/@P @K 0 0 0x -LM0$̓0P K (@ 4/@P @K 0 0 0 -LM0$̓0P K 4@ 4/@P @K 0 0 0ꐔ -LMZPp " @0SP0`K 0$0`K  P  P% P P$P vPP0 0R%(K P 8 P PP0PS 巗ᵗ@P(i(字PU|P( ̊ -L`TPچp@  PP ``P` -LMK@Hp 0: S  p  `0K 0 K0K -L$M@`< /딣$0 40 080 00T0Sd30@0 40o e0D0 @P U0@ p p0=PPu @G0 @0 00` ဇp P PE U@l0S4080SL4000 0,  A0+N-'Ydvutsq9 khaB6b` {l s| 0SjtKt`Kr K0 SRV r0 QPG 0P? |0P, 0 ! -R ?S$̟ o!0Ȃf KY!aef+1aa <0Ha0 IQG \p  HKu0|   00 5p0, KH0" 0 | t0S 0t  pR05|0HPK00: 0 uYH0[S0 0 R Sp0h000| 0p|0HPK0S00 : 0 ^uYH0[S0 0 R SpY 00Yp00Džp|tKtKqt)HPK uYzH0[S0v 0 R o Spk0  0 | @p^|00 S0ڜYV 0R  I MQI SpEYC 00Yp00Džp:|0P  1H`K0   tY+H0[S0' 0 R Sp|0ǟ0 / b !S 10HPK0   tYH0[S0 0 R Sp|P'1 0HPK0  tYH0[S0 0 R Sp|0 1 (0HPK0   tYH0[S0 0 R Sp|d& 1 0HPK0  atYH0[S0 0 R Sp|0%  1H`K0  DtYH0[S0 0 R Sp0, KH0" 0 | Rt0S 0t  pR05g|00 SW 0Y^0S0Y 0 R S YpO|00S7 YG0S0B 0 R < Yp80  0 |  p+|P 0S' `PoP Y0 S0 0I0Rp QP 0|    ?p| H`K0 00C# K `/@!b10   sYH0[S0 0 R Sp0000| 0p|0H`K 0R  B00C" K  B!`1 0  gsYH0[S0 0 R SpUP|0" 1H`K0  EsYH0[S0 0 R Sp0000| 0Ups X|0T! 1H`K0  sYaH0[S0] 0 R V SpR|00H`K / b !S 10   rY=H0[S09 0 R 2 Sp.wP[ ų gX 0   p  B/A!b@P y0   00 p  HKtqH0[S0GK0 R Ypdn xp1H`K 0  WqYH0[S0  0Q YpomP} k  HK:qq -LM@`HKDP@. pPpP0 PU@@KLa p-@PLMK`@,`0 7V@@Kp -LMp`PL@L0@]l8 0 P@]$K`l -LMp`Pl@l@ P]lT ,K 0`,  00PU``@t](K_l -LT0P DQ4z  p_T@Y 0-@L@@ 0<d0R0@-0 T@0PP0Q 0@0@ T D00^h =z0@-L00 1@UT00S   0̌0@-@H00 1UP0S   00 !0d(@-@PT00 1 ^R`WV!  00 !0@-H00 1@UT0^  0 !0萋X000//000/t00 0/`0P /0-@PQ@0/0P /0P /0-00S |0 \\ H0 0000 00 9T4mNA -LM 0 0pX!G!`00FBK(OPEXdIABd`)YIST000H 刀 1X@@T$K<_ N< 0-P@L@P [0S 0000P$ K0h[8 -qp L` @P[ @DR000CC110 0XaX 1D0   p [?X0H!H 0p 0 0_1000CC1100XX0  00p0 00  0p@0 0?p0p 0 <p 0H@ Q[pX4x4P -! LP @g`1[ AR000CC110@H 0T`F# 0 ठ0 PTP ||00 Q P [< ,pgqp0` Zgfffx Q t| 0-(@L@ @ZPZ08 -@`LlP# 0PaP`pT0a0Jh@X 0`AAZ0OZpG00wZoTAXA\AXP O a000  D. 0-L,@@0@P00S@0 -@P@_}L`P(p0@aadZ0OZZO00TTaXa\aXP(0(  0 0TT 0-0 00L0S PZP0SZ 0CsX@ R`nZ0@T P PP@\ZSx4 -LM1!0P@Q0p00 `O VE V8 0)  `00S0K0 0K  x`P$0K sx`P jx0`SDV/0KT  KmxP74.0`00 0R$(K ` 0 ꀐ, KⴀK␐"Oxp`  0 @`[M0 0 0K.xPbSP --LM00  K -Lp`шL0L0@DP mW  ^ Kh*PHT8 @-x/ 0SAS/0-$(0@# A  A A A0/Pp@- P^ 0S^ `@S 0TT0`0`pPPpp -LM4 Q@ ! 0匐匠 pP4`0 0 U`@D X00 0   slP:04 0(K(K^ `Z I XZ -LMpp P#NK` <0 {JP  Xp  'P0 0R:(K0@0S+ S 3NK 0 +l0S 0%  0l 3NK0 l 00S3NKP 00SMTNP\H H -IML4Mğ @`P p0 PZ 0S SJK  P0 0R(K JKRC JKRU# JK A 7S] S0Sg0S  0S0s S0S 00 0WXP 0PJ=K0C0w 0PM<3J-K 0P 0 0 0/PP 0J-K S R 00eS:@PT8 0SL D`D V> U 1R* @@@0T&\\!^\ʔ 0 0 R0L?o20S 0Rp0SR pR ^ pU R$ D0DPS 0SU R D0DPS U RT 0S DPD@US0SA-@dQ M%R @ 0S  R 0  0S @T0000 Ѝ`lq ᶀha( R 0 0-PLP0@0T 00@Ă@0T0@K0h躂 p-L M0PS `@K`$` $@0S 0S 0SKp -0MLDMK@(KDLH B00K 38L#0 KLA K P@hK0`F0 (Kp1< BP0 1K0@A00> 0PS x2y K<A1#r 01t(0000 ` PPP  (K8 B  P8K80C I008K80C 8KL0C000Qf(K 8 P0 K@@0 08  P '4!48C8S (KD B 8#80(KD B0Z{8KD0C0S8KH0C0S S S I0 0 0(KH B08KP0CD0C pI0 0kI0 0fI8KH0C0 0n<P7 @ -LAM` p0P (0 V@ @P' BK0 @` Pf ( 0R$Kh0 RP @@ .RB^K PE $0K@dDI00"<9P P 80 0P  R00/00 $# -0LS S0S4  R  R R R0 S 0/ 0 0S S S S S00 00S0 S000S00 00 p-LMPQ@`  R R Kp R!RR Kp00 AP00P8#<48#8V R R  `0 Kp  Q Q8, K P 0  Lh0  0-@LᡁP0 -L$MT1T!0@P P`0 = P, LKP% `D[,0"QK⓮ lPD1x00x02`{`X EX|0#^0^@`{@L0P$ Xw! p! $ @Ii -@LTMplK P1儡0|0  gP0x | x0 PL 0  R0S R R R0 T @P`LKp0K L KL` P0p0  xYP(Kp`V`V 000 j`Vp0S 0PP0ST4 , -LdM`pK@T}P0 plPK @0p0P tKxK 0 a}P P0S004 (Kx]P0xztKxK0  B}P P xzpLKLKxH 90P0 P0 0 00S[B 0  | -MLMŸ K0$NpK(AS 0 P K*K, B A h"K A X"KTK A0J * s `P@ 0#S2 =K0CP, P=K0CPP# @P 0S   @4^P* T 0S S S@ UP0P^P 0DD`P0@=K$0C00 0R:(K@K=K L(0C$L=K 0C(0L$ L$@ P=K 0C0(@T =K(0C`@T 000 IP =K 0C0(=K 0C0(@z P p \ \ -0L,MD@K p`H0 tt>`$PK$% )P @0S @HP (0S0 K  -&MLM&LK\K,N@D̟P MK8@D(@NKN K&K@00 0K0L` 00S 0!S <-K0, B0=K0C P4"48C8S pR=K0C*0K=K,I0C`I0  @-K: BP0<=K0C00 =K,0C03/P/ 0 SS00R0-K< BS0p% NP&,K`&,K B` K4A@@ &Px>0@0=K<0C&,K0 B0S E&,K B& KQ =K00C0&K0A m Pi&00{=K$0CpRJ.@ &P?-K B0=K$0C K @(%=K 0CR0:$%R7 %r4~&,K B-K B R  P\ P @0fIw`PT 8 a -LUMP`ğ` X ` p\1 0 ` tP tP >K d1 {8V00\1S0  P X0  @P4A R@0SV X0  }P EvCv4`10 0R(K0@l1 @=000Sr  .S 0S Q@Q@.@DOoBRc d10R:0  YPʲ=0Tt1 0  DD@Q0p1 h1 &dATQ 0 N DD@Q0t1 0\1 ] 0p1 h1 0 1P=0=SA =0S S" S \1SI t1s]h1S^p1S- uul100Sp10p1 0  Qh10h1 <.K qPJd% 0 0 PBD=00@=0 0[ u9=00U0p t1 h 0 P'ʭ0 P #=0 t! rt1s =t10=00!v P -LMPpU`@ 3 0 S[ PP 0 K0 0 00 00000 |0 x0 t0 p0 l0 0KS5 S S6 <00<0S& S S!0`  0 0 0Pd KH d0 `0 \0 X0 T0 P0 L0  d1iH0S 0(K0` 0 0 0`  ` 0 |0 x0 JphP d0K0 0K8 0   0100i?0 0K0 0K 0 0R( KP! 0 `P 0!K 0      1P0StX  d1 )h0SD   -LMPŸ @ `p0 ' ,(p! fP PW  PQ P Qp0 0R{(KR0@SW J0@S0S@2 @ #>KD2  1/K0KD2 )@"?KD0 ?K P@"40SD 82Z@2 0 SH2 @2 uPH2@"D0Z: 0S ppZ: H"  0 @ Z R  QpTH"JP@D2@" M ~tP -@P`p 0L0 0 0POA000 R#4000@00@/G-0HMp 0@P@0 84 0<U0 8`'0 `0`& `8lP.P00P%P8eZ@.@00@$@t8G & 00 " Xȟ0b%% `0!08`<$ P, haP"`P@%$`Wǁ@#P @ $(PGi !@ 0`"`ว,0l P, P00 P%PeZ)+C0)0O B @# @t4G0&0  #8 P7b%%0`0!04<`<$  P,@ǟaP" P@%D`Vǁ@#P @@$  b PF ,@  "00m @&0) 0 0#[4@&0& 00# lIp&0% 00# b&L6$0!`0=0`," ,PD` ƟP# PP%@lɁ`U @!P@@$  b,PE ,@  "00m%0) 0 0#[@%0& 00# lIt%(0% 00# b&`@,@$T4@ᚃP" !D a #@@ , pğ @$ @)0$ 0TDc>@`! `&$@8ğ `j P"0@P%ğPeX @# @$<@D&0,#0l΄ %` )3`隌0 $P !3 Pa0 ,@ ",0S $P0) 0# 0tc8c>`!, D@ `TSj"PP,PeX,C@# @,@ß D )0$0l̈́ `! b0`Ԣa 0 P " (0P0#@@E08b` )` xŸi P P%0PXbe[`0 0#  ( `020*@@(0bE`0 ,D` l̈́  `!PPe[ Б0  0#<0ม8 ` @`&`@e @! l͆ 4p P " \Pb+@  0$ 0,@pRL`0p: pPeEY@0Y@@I $Kk -LM@p0 0P(`K0 0  p!? 7R8 bx b   0RX KhnqP -LMH"H2 0@480 0@ 0p 4K1KO 0SP @ 0 XRP@P@0 ``+ T6 >.0 N0P,B,RS R+00@' U% 0H0S* S5 S. P 01n(."4n#..(.< 0T. , a A  00C208 CRP800 0R(K^*30[4 [8<^*40[^20[3[44 [8<p.S^ X*0p DP -LMK]P K -L,ML1L!0`@ TP0  Xpo TP8 ?o2T0S E0 0R0(K PK @:, K#<@$S X $ CY ,0K1 $ S0 P, K!0$ R0 0S kpPT -LrM@ P` p( tKe?K1 |@ x@ AOA0TAXA\A1 mP    0 {K dZpp 1@nP ( 0R $KP uo00 0p0p0PB- 0    -- LM 0  K --L M 0 0  K p-L$MP@-tt0l $ ,K00 4 ( 8 ,@ P @X@N8K`QV Kp) (H r-LQϠ\ KhXo -LM010!0p`0 !(0 _p@ PK  / _p 9^@( 0R' K0^KP@X @@T PU 0S*P@KTF 0@0aodPi 00-PL@ P0 000n(0Pn(P,Pn 0h0PP 0P 00 00,,TP 00 0P H 00-L@  凌 0 00 00 0 0 0 0-LM 0@P 0Vn 00P 0   54?o20cK0=' 00 0 0-@PL U 0 0-@PL)n0PP%n0P("n(P,P0 -p0LP`a P[ 0 S S @0 S S 0PJ  @I8#< Z @> HrPP# @C 0S@ P@T! 0S S S@ 0AS APPPQ0000lP Q` UlP@t `@P -LMp P@,0(Sn: x(PTX &Kq"[T4"4("4"<8#80I 00SE 0 R?@D@T0: 00S6000@DPP@D`% T4 00S%P 010P I@0`" 00S0AS00@lP  0(0jP}@x@$KA00$K"lP (,@ (P 0-LM 0@P   p P K0 0 0$ $0K KP K05p 0$00$00 ?K0 -@ULTMPP`K ` @@0PLPMjPH @@0 P=PPPY * 0p` QR Q3 0S*QQ   pQAp 0S`:0S b j0P\0   \0  @h `0X d0  R  R RX0S R 00I @T: h Xl\  0JR5`0 (K  X  0 LKX0 J띀d  D H * p 0 @` d0 W G`4  @T:@`0\@l(K  HDS QAR  R p l@ @0p P AWU WK Wi p WY T' QWD W: Wp` ` @`^ \LQ  QAp@ \ ^ Q\2 @`0 @k(K` ` `   ` R4   0Pl@  @T:#`p zk'pꎾ4 rk\ -'QLMpPo| ຕPi<h`@0p000K C0 >0  90p $p$400Z(04Z`30!,`501,`%W1 -  (``P `80 Q 80`C ` U  P0!03S `V: PVXIW(K`W,`0W 3 #- 5- % 1!!O00@j(KF@00(K0WK #((R` `84`F2`F1`FS 0?`FAPV4C  0F0: ;0(K0X' #((RP P84PE2PE1PES 0PEA`ҿU0  0E08 90 :04  800 A༿4Aൿ00:`08P -LMYp@% KB[p dK!0R0%0 @PYu 00p0 0@P  KY@ KZ KY0@0 / 0-L @\,\@ \ Q :^ : A 0n00i00 -LM$@\PH 80K( V8 0044n:KB8@L;0zC$07i8 1y-`BCL^8` 4 0 ` ^   00c8 0A932 3 A00(K  0 00-SL@ 3/K0hi -LM8 @<S Q `'`8  0P  @`f&PEE AA!`F`F!f&@@ AA!`F`Fa&P@PEU% BAA RG! 080R@\RRc  B10`[8R Y`00K M 0pI0 PD0  I@ pG`f&PEPET%@D D&"`F`F"f&PEPEX% B B""`F`Fa&PEPEU%@B@D Y0 G$80Y@A Y Y 0L 0H 00K D0 P 00` 1 B01 0DP`0F0C6# E B$"@D@DF$0C0C$6# B B("DA!0C0C1# B B%"AA! 0(KYY& Y" Y$ 0 0KP00`Y Y Y Y 0`p0 B01 0P`8`0\0X0T0l0h0dy7 ` D 6 -`LPο00s !R ! PEU6@  ĽP G0 0  yPU pWU@Pp X 00㦿  @@pG  X00㗿  0 @00㌿ -$1$!0@L P0 010 00C11.R 0  0P0 : S` P @p0l0Fl0 @  00C10 B0@@ ʚ; G-5p%0  M0\ 00I10@ @\` P @R P@\@ p`0IAP@@pP@\ P- PPPp0IQP`.Yp ಐ@`@pWp `p@pEI2Y 񏐓}#~}|{zyxwvutsfqponmlkj]hgfecba2cABdQelQL2Y REPONMLKJI(GFED#BA@3>=<;:98765432%0/.-,+*)'&%$"! 00000@000@ 000@Ѝ002cABdQeQ00⊐ಐ 0@  p`B 0J ಐ ` p4 p `p,`!0@`p#h -@L Me| ⒁$2al B!!0C H M!!1L ,0@0 } KЫ Q -LAM@ PpBnK `Fp 0( -pP,4[ S ( 0R$K.gP0, -@LM`` Pw-pPGP 0S 8 8K00S.SK -LAMd0d0 @\B^KPEp0 `P  0RKf@P 0-SL@P` @0S IPV 00V00 -@LM`pPU 0V0 R PU_L0P0` W00KW 00K p-@L MP`t0S 0U0S @0SOL0@0P V00Kp@V00Kp8 -@`LM KQT:8K,@@ 0 0jKp  Q 0 0{0 0v -@lLM KiQT:<K000@@0 7K贵  -IMLMT ş0@@P@ P4 5l 0TX4 0p00 t|5b0PL4 h 0 0@5mK0?h4 C>K 0C`FH4 0 ` %  /\ ` d$ 0 \PiP400Z0S T40  \4d$Sh4 ` .KW4D4[S@dD@H4?@H4P?l<0  K&0SLdP;0Qb0PL4  0 X40 0R(KWH4/0)S( 0L$C @ ZP L  %0S *f$  JX40 0RL(Kod<H4@!( ?0  JT"t  |$ "判  $ "d  $ "p p$ "唄  x$ p JpGpGWC4@ 0$PRT`) U | @J뀤tD   JX 0 tD具1l$`F`0 00 .V 0 xqꌁ 0 iUl 0 aꈤdt唄:P4SZ}T40 y  8u@ 0 I0tD   7JX 0 tD70l$`F`0 00 .iV/pel  JDdhPX\T H$ x @Z  D | -LlM\@Kp `딅P0 0LKLPKw  h  l%[`1l $[S` $[ᰥ[d 应[ + 40hA  l0 I`1S   ;`1S0 ஶ  0P  $P  P   P  P  P  P P`1SXh0SZ RP_ 03I 먂 `0(I d0 I \ 0 I`1S   ~0 `x 0 `r@0 `l0 `f`0d 000& (K >  h0S QP_p 0`H #d8 H(K (K 0 ŵ!0 ྵm0 ෵[0 వH0 ੵ50 ࢵ"| 0d0 $ <P 8  ( @  ` @ 0-@LM Ta TR !T^ 2Ta QTPK0TI T= /TU lQTP 3^\1P@0(  T0  TE (Q TP @T T) Q TP T+ PTP P TP PTP P TP PPPPPPPPPPPP|PPtPPlPPdPP\PPTPP L ػ d  X t L ̺ H \ ` | D 0-LMPKO@ xPK0 0P0( oK0p 00A  M-L@M0 0` PPpKP @ .0$T @D 4000 0R K$00. 6aHP -LM@8 4 0 88PK4Kp90K`50 4 4Q0P RP (KR `8-\ 8 +\ 8 #0@0 0ಠ 08  Q匠ಠ10 B011.\M 80 @T@ ppßW' 0S#380 @ \R  R 0S#380 "#Tp 7))8 *,& )Ġ `& &d0*8*p  ` 0080   080   0L080   0 B   :80@ p @  T  R 080 @  S # 2RP T=S; 080 @T2 80@ @TQ 080 @S#2Q\ TS 080 @T@ @ f ca8 -LtMQ00  S 0Č @4 8 Ȍ@<̌c(#@"$l,.,aH!c$"0l.$DŸL80 0a$ ^!<0 2Ÿ040 QS0N0a@%`0 N2%cC2`b2`bfa@1AR@0 :D0 W0E0PRReQN0 bd0 $2!C+J !; 0!# =+J   +J "  " +J   # +J "!  +J J! 0;J=K-K<0C8 B0 EPDK@DK =K0C0S  0D; 0KAD+ 00KS0+ P0S"  K@@P`q0V4  0d E =K-K<0C8 B0  PD+@T=K0PS=K0@=K0C0DK T:U=+J01-0 30;J0000;J020 20;J0J000J;JJ+J01-0 !30;J0000;J0 200;Jp+J0-1 0->JJ C C Cb=W ꫝK I @PQTT ,n`=K80Cp=K<0CPD0Q00 P'0PTeͲ0 PD>0d D  =K-K<0C8 B@P0 lP@PꫝK I Q@PTT d 0@* =K-K<0C8 B0 PV9 ]@D;PD;@0VD; . 0 d =K-K<0C8 B0 PfS~LM0@0d 0 =K-K<0C8 B`P0 PND+0D d  0 P=-KD; Bp0SD; *L@D;0SD; * 0 d 0 PD4<0d D  =K-K<0C8 BP`0 pP=KK K$0C0AP`@p@C 0P 0 UP)O=K0CD; D+  PD+ @G-K BD;p0D; ;0d P@ pc =K-K<0C8 B0 )P=PD :#D;J0D; P@0d F =K-K<0C8 BP`0  PD D;0D; 60d - 0 PD D90d D  0 P@y-K@`$ B K KA@ 0 BsPi=K0C0D 嫝K IC \9P@PD ' 8i`=K80Cp=K<0CPD0Q00 PD0PT^0 P7 0H+uHK۰D 008B0d H D  -K8 BP=K<0C0 ~P`D;-K-K< B0D; -K  B@wp-K B R9K D+P V  K@ 0 UP `0d @} 0 GP`F@P=K0D;9D+47D D  0d ^ =K-K<0C8 B0 $P=K0C0D 嫝K IC 6@PD ?TyTd f`=K<0CPpD-K0Q8 B00 P0PT@<-K8 B0 PD;P0D; D;@0D; D5@MK @DP02 D  =K-K<0C8 BP`0 P_-KP`$ B K KA@ 0 BYPN ,5 0d =K-K<0C8 B0 P;D@TD % -K B 0R0-K, B4`BP`4000 0 Ǭ 0H+^Hkį D 00CTH D 0 =K0C0S=K-K<0C8 B@P0 eP ^D;@0D; XD3@MK @D02 D ~=K-K<0C8 B`P0 BPKA0 D VPD =K-K<0C8 B(C`P@0 D &PKA0 D :PD =K-K<0C8 BP@0 D PKA0 D  PD =K-K<0C8 B@PH0 D P-K@P$ B K KA@ 0 BP>vD=K-K<0C8 B0 D PgWD =K0C0S& =K-KK<0C8 BA0 PSKAD;L! 0A=K-K<0C8 B`P$0 PP=K-K$<0C8 B0 1PHh`m=K-K=Kd<0C8 B0 P|MTxڭ=K-K<0C8 B0 Pl=K-K<0C8 B0 Pxp -L M`^pA@0 <  00@P@pĜ` PPK蔜MM$000 1 2Ѝ/h -PSL`p@@W V:0@4#DDH$H@PU 0PL@(00V@D : 0-`VLPA3: 0@4T0, p 0 40@T"T0TT400S0 XT0(00$, P@@( 0 0 -QL MP@`p$0S 0! $, (0v(`V{0Sw(0S0! , ($P, SG100Pm, 0 ^,0a  ,  U$ ,7 \P: `$(,b"  b$ $, 04 \0,::(00, (0 S)PU$P0 ( ,0 K0F P&, (` , (0 0RTPTP(0$P0Q (0,  K0 Ki 0 d( 0 0 -QL MP@`$0S 0! $, (0x(Xp0S(0S0! , ($P, XT̠ 000gPx, 0 Q,0l U $$("(!,  $$("(!,; \T: $(,b"  b$  !, 0$"448#8 \1,::(00, (0 S)PU$P0 ( ,0 K0H nP&, ( , (0 0R QQQP(0$P0Q (0,  K0 K輮 0 귮( 0 0QC-W`@p 0 <S'A&a$Œ?pF$@`P pP0 < S'A@&a%Œ?p0:P `QP`Q Q@ AP <@0U,``Q`  ==Y*0 0h Xg -L$M` @ğ4 0p00 3P0@0 3 040 30D0 3080 30H0 30<0 30L0 Q 00@{=Q 0廜0Pr Y6 Y Yy V XhTP0C10Q_ 00@t=QX 0PU < 0C#" 2@T007:SHQD 00@]=Q H傜0P9 V@ X48 0C#! 3@T007:S'PQ# 00@:=Q} Da0P V X4 0C00@Q 00@=Q @H0P(K PQzY(KV@ P T* P P Pdb` P]PQ 00@=Q LP @Y  YR 0@0@ 0S VX0S  R 0 R0 0@=R  NCU@ -@LP`BT @0 x0U ࠱ࠣU0 .PF0 #2 S7`0`000p 0 S7`0`W00 ^P ^00 0 0/SD0 0o/HSD///t -LDM @0\`K0p2 ( 0 RP 0 PC P( 0R KHSP<` - LHR0ŸL %ȠiNMhCK4 A8 葟姢d@L I"!'b rjb%)@ LCqc`Q@p0 < aN2<0S9VAZIU<0`00 4`K0@K0 SP#X0S    00000000S0 @(K40K0 KWjP40K0 KD<`PV 40K0 KHVPZ 4`K0@K 0 MJPU ꉈE.ų%I$MnHRh -L`Ppx0S@2` jT#  0R.S@0D0bS.P@TD \PT S\P  @0. 000B @  @ꝫ(0 0 -LM0 0@^KPE0pp  0 PBnK`FH P *o 0RKGlOP 0--LM0@R0  c,PP*K fKG 0-L@( 0`00K0h& -LM?  _ K p-L Mt0t 0`$PK0@  0 ȣ 0 T0 00⼣ 0RKpsGMP -LM0`Q`" @P0 Q0 0(9DP 0 p p2 H4hB 0d2 <40l2 440t2 d#@P /K "h= P R 0S Sv 0S So p@T `"@1 GTh Aqd2 K:P@DQTD:Y@DP R<?Klr p`R4I QYP@Dd2`lrd <Y d0W @DP dr  %0d"R@D} qPU &F `2` 0 q00(K`(KpR xb|R#Yq0 S S0 S S lx" 劔PP0 0C?ox"20P  x2 |" YPx2 p"W|"A* pSUa R^ @xb |R pRtb@pZP @T P P P@ P W:( DP P 0G0 0xb.0 h  E(K( Dp2P 0p2 w pGp|"x2 E`{. Z . -LLM(1((0P ^`( p+ X@K .0 P' W Ԁ0`0 e0 0 \K`KGP `bE  0 ( 0R K` GP `@`HETEHPHXU ܞT -LM`p`@PT) X ``0,0 (K,K0 GP ,E  0 KX`` ,J@, ET KDGP @B \B 0-L@`PQ 000c BP00 00cRE\00 -LOM`HsHpH VL P@0  V 00 /0@0L10 0R(K0Y` .ᓗP "0 p S S  "! ".\  RF\ Q.R@ 0SyH0C SH! r0 p@ Y0P1 H! hP P1 @ѴH  H1 pG 0H1 P1 V`WR:P1 IH!0` Ha C 0S@ 0S= RKK8  :P1 /PP1 S  :S.S00<##40S0R.S:S+ H1  @A 8! <1 4 0 0(0 `0  KvP@W00T00Z0@0M<.K ẵPPX DEP5X> XBO -UMLM@,5 0P<˟< 0U `8  T0D% 0  P@  T T   850 0R(K:0(5 (MA0P45  `4"48C8 @VS#U p0 00 0P0 5 0 (53/P @V:,%0B?o2d5 R0S<5 D5T5 04P04 H5 0\5 9$0l5 9't0-Kt5 9 B0p% xM.K0X% 'x P% L `5 pWK:P%TP#P2UE 5  A  PP0 (53/P @ V: $  P @T0sU<Q $%R# ,$%Q PB'RUPPP,$0T%`%DpWP*H%RL @45d@P5@ d5R00Sj050S, 0  050S 45LU@C u@@0GS ?:0e BP5X C  0GS ,:ן0@%0TUԢ@T00 % BR0S  L545 4B0@%060(5 5PT5 巢P0% P( P@P@D|&P5  A  PP0  PTH5S \54%L50Rh*45U0P45 ႢPPU H50H5 P,%$ RQ=%C>K0C  $5 0PT  K T$`5 % BRPPXPU$增5D5  ,% R R R kh5 05&PPh50% R$%R H%R%i   Q p%P Q*P $5 %$50P 5 $h5 Ph5@/C>K0C  $5 4 0P  h5 $(53/Ph5 0T/\54%L50R455*U P4% P=P$U 5 CR00X0S/$h5 &h5%P05 fT%l%CP`h5 05 $% ¡$% h5 50%@E 0U05P,0L5 LA  0 @%00%5 t%uCP5QnK`FPpX.^p !l1   h!0S  rt1p0\.  ^U00T0S @WT@@PXT` H5S]ڃX5A 0SSQPVP"\@FA05 0SJQK % A0QDLU(Q@\5P 0\5 45L 0C0B K @$5 )D$$5R@$R<$r LU(/@\5P 0\5 g 45L 0C045  ABP\M LM $< H -LM0S`@03 S.0 0>PPp1 bP: 80P0 P+   0`@]V 00S S  K0 0V>PPp  0 K@>@ -BML M2p0`  8 R 0 * RC>K0C3K@ d<4 P0u# I0@%T *V$$"<܎2P  0 840 0Ru(K 0  CK  @ ! < %=@PE ϤPP@ 8<0@ 0 ڰP> 0P00<$ 0 0^O@X6  0@C\0-  R     @T'G 0 0ᨤ 0 $@ 0 @ᘤ 0 ᑤ 00S Sᆤ@,5P4B A dA -LM`p\@P0P0 0  `0 Pa(K`0 PP -LMP`p4@P 00000 P< K0 P0 RQp-L$M``@ P/0S9 0S 0S0s7 S 042 1 00 00( 0 ,K,@ $ P P0@0KpR R ȣ@/ 0 0Kp0S0@0  0S @ 0 0Kp0\0#$, = -LLMPğP `P \0 0P X 0 T0 (<@P 0p 4?0p P ᰍPP 0@ K0 L P0ð RR RRd0 0` S Sh P0 S S HP 0   R+ `sH pPp``t0P@ `V R R R`  T:(=P pU 0D@ PH\0h dS HDAA`C\ 1XVH@ <:`FR7pL ᢛ 0p`F0V(: L0 咛L0T`FP0 \` T0 ` >>  |0H QpR`FP  v@T`}>{>ˢ 0` T 0P00 0R4(KL  P/ˢ P& 0 0` H0 עH0`9XH g0H K>0T  `00T 0哢00`@ ` >/P P  p-LM@P`0000  0fKpԁ -L M@$$ 9 Khl 0-LM@P9( 0$0  0K0 0-LM0 0@PU 0t  00 000@zT 9 PK0ᲸPUi00*L -LM1!0@  ,pKP `K0\! 00 0 L RL0100 L.\U 0 00K R0 XS 00 9\0 \ @ PE U,( $ P(, $Q0 8 c# $Kc4"0, M0\) -L4M2Ÿ0 @P0`00 2 P%0P@pK:U@0 00 0H d2 0P0 0Lp \p  pP`H 0 KT X YM P0 pWq/000 0Rr(KN@H0 0H00H0 PPP0:YFW T0SH0L PT 0P:U`H00S L X R:L*$ pL HPY\p0PK L 0U:*L0 T0S$ L R 0BS L0Ts Sb 㪙.Y`\pL00PKYPL ʅL0SQ='P4 -L(M P0pt 8`K@ ( !P * Ș( 0R$K͠0@0$=$P@2 -L|M|ß|  P 0 0 PpK c0 @B1T0 ,PK2\T0N` 0 r 0S Q r v PQ  0S` rq v00Y0S Y00`` `0K0 2圐 0@0 2KT\ P UN*:0VT0V J1 `!XA@T V00 S 00SV:0@0Tv㜐0 `V S$*: 0 S* 0C\ :@ 0/ 0 0 Q1(K 0  0 v0   P0S S 0Sl0X S0 J ᜐP ዛ0d0S <<$Pd0 -LMⰕ ,K0@SPN ᣒ(XZ Ur U U 00ធ`(K 0`p0S 0% 5% X ;0͏`P-,KP8/0 QP$ 00P @ P >;00 0 00 d(K藲 0* RD ;0L UW,K-KZx 0 008/0 QP 00`P\ <`Vd|0  0P8/0 QP`p0 2 0 0 `VR <`V,K0 P,K0Pg0Svᓐs,KR0] 0`pfKp +Pm%K K K 0S  0C`ppV  Kr+Py 0N0\L 0<`80@ V0 0-KmK KV ᩖ) YFmKL00c` 08/0 QP$ 00  P  @ P m:00 0  0`R0 XP 0S : 0C`0`㈑`弐00 @ V0-K`pR2 K mKV0\`F0J00 @0\ ,: 000 V`Q`l0x  -L,MS\0p < L  P <`D0 L0 D #`8p (00KH0 WPPU880P 8   p@0 8 ؖ @0 T^ X0 00H<PT 0P@@V@TU 0ED  R% DQ DRO 80Y5* 0 LR0.  PZ CYR Z Oo PCUB0P @SQ00 %  ED Q" P@@@ @@ T @pZ  R0@<㵐0P0S8  (KSy P0L\  @ R:P\8 S00 8 P@kL0SW HP Q  0DPL@Q %Q# 0Q 0028 <80 k6980p(K @P rL ^ 0 R R R R Q  @ 0 QV R -@00LG`F0~p 00QP0P@ :0TS P3 -L M@P0.S00K -L M0K#@p@K R .S.S Q0B Q-RS  .R0 .Q AAQ0B Q//0*S0.S S /0S ! C]R.S  .SQ \S  0 "!C]Q//]R0S! C//'"0 0 /0 0 /X /0 4832;:98-6543210/.-,+ )('&$#"!  Y30@R]PY&lbjC⧁j0C000@Y 0@00 pPk P.03052f:ʛ( 0 (KAQd R4 1 0cRC1  R  00Yp K40PS`(HQ4pPpG W`WPW&4 8@@T)0@4I0Y "<P`40 4pW 4p 0pg'P`0 pgl7""P`P*00000@\ 0 !  Q `  -L,MH0 0P<0 4d0@0 4 L @08 `P0 Qp- UH [Q` ˉP @Q P @Q【p ᵉP @ Y80SPQ@p<0 D B08< P<R  8 RÄL 0CSH R00(K\Qz .Q<0 0D0CPv8<Qr<0Q S.Qj <@ @]iP 0pJW00 R0xSO2@ 000 F 80p SZv0D /R_ ]RGQ)SD0p2080 SZgQ 00S%0HD 0c3 X A0< 00@SV .SM< PDPT0  0KF0  T0]R @p0@P/h( 0 (KQ  P D X"D 0S 08 pZ R+  P0R 80 SZ(@3 0 (K004S 80S„L0 BRH0S0 0,80 SZ0  0 -PaQ`L@16*0pS. R/ 0wP0*X'*P@  @ 琠岐 T  C d 0 TC0@Sp0DΙ(00H h R-P3P#RP3LM U `4 p@ A0 <0  Q5 @P P P (00 (KV@Y?00B@S00PS@8 P8 40S @T* P pP<0p0G0YB -LMP K -L,M`S@@ %  Z< ` 0S `0SPp PpWXP 0S7(0p0(K<` -p00(K00 00 @0L` p0P 80 H` PU 80P`V* ᪑Xp@ P00U0S <0H S%*40 40`40 V 1 HY0S - P4?0S``VH04 Sט00Ә(000S L 0CR* 0GSP0S 0P0 00pL0 D 3D 0 PP P 0AC\ 0AL^ \ 0S0SY8 0RH` ?0)40@0 pBY<`AZH`P 00M@0pFN? -LMp@xx Pp`~K 00@ p@  p 0RK@4P -LMpp @J_K`p0 ( p 0 ( 0R$K4pPQ/!0S/P0R/\/\:00/ 0-PLP*0@S @R R R ( 0 0P00QzP Q0@S Q- AL 0S R: BR B 0S  ڗ00Aї(00 -L@pTPP2 !0W$0X WXTP` 7P @TP0P  P00蒗P(00P_oR Q-L`@S 0RP@`V  0PR@P0  -@LTA`pQTPAPW1Q@F?00A(00<00 Q-AL% 0S" S0S  Q :AQ0A 0 0(0 0 --LM00  K -LM@$K*#p KTKR-0S0 \ S \00 -PLM BU"R0 4 `0ph p@ P-TD `+T@00Tn U PV^8 J3\p8 " ^-  T  R& @@0D \@aDQW@DADQ 7@DTr V^  T  R  N.@`q l 40S R0J00 0 40 (K[04 0R00  (K8 2\hp8 XQ 0A P@P A@PUP 0 0 0X U -LrM@ `P eKp( tK |@ x@ O\ 0 TAXA\A{KQ Q 1( @0R$KQ2 P- 0    -- LM 0  K --L M 0 0  Kd QP-LMP4 0 d 000S000s !R !p 54 @ቆP @H@` #/1R8` = 00Q*R  "!"""$"( < C0P< / 00     0 BX@p @ ROP  0@8p 8Q 0080S  (KbT 0 @00(K0W 0 -@P`pL0 yP  0-P@L6 K0h -Lp`P 2t0t0l@  W  )@0  T2 $Kk H4H+ |y 0-@L0P00S  3/000S0K0h  -PQL`0 @@P 00U000 -L@pP` V  y0000p/PP 0-L@PÑP0K0h! -BMLM@q1pCnK`FPF0 0S pP@TP P /0 @U:X /Ppp0PSP @TP 0@U:X /0@@00iMQKx00p@@h KPb K<00 :~괇 l0d8@ 0-L MP @0P X00 H0K0 00yP K0K0pH -L M PRP H10D0SD 010a00q00@`p 00 #).0@S+00儑 000S 0 000 00 |0 00 00 0  (Ko[(00$1 <$dX< -pLp0S P`0 PS0@P`0S  Dw 0@@  0"P d܃ -LlMx oSR|0 3P0`t @c#00 0SSP0S00 3ß0 t0,K 00 0P W @0P<3<00 43 00 00 pp VA2 Q/ p Q* P0S@ x l 3/0 10p0PU@RPT00Sap" 00C0T@(K0,K @ 00OP 0S t0P | 0PK0L ?P 0 SA` @@@10PT `0QD 0 R? 0S,0K<#0`!` 0@d P] <@@h0(Sd  d @0@h0Sd  d @0@Tp p1S MP3 0@0C0,0K<#0  0@d ", K<" d0 <4 <X~G-MrX2ϠC2l11Pe 0Ss z:SjP @2 c?0c01NT1@Ґcǂj1 @P 0 N➌ϠIlǣj@ L`?@1c1c0\0B0P0BPDڅTa ` a V ڀ`@\ P 002c2c^3P ALRAPE l lT3 l P 0S :S 0Ѝ002c2c3P0@02c2c;P3:=00C02c2c3Q*gfff$IP0S$0-@/BA#b0/QQ-` 1 R 0PR0P 0 / P 0V0 0R 0/0 0S 0 0S0 0S0 0S00C0 -LM@K  `0 0S0@ Rౌ8ȟ౒ ?c0a!BS ! BQ  R\0A4(E4ȟU@!"A P/QA!bP1CQ0 10CR00SF \ @矵G0圄ɠ`LS  qpGPppW,0Jxǟ@ P%v>R 0T\\\0CQHLKB`PA`A\ \  R SSUT 0(K @Ɵ夦 N _eSeQQCRC@ T BpQXo PW @ S v>C 0C;R 0 z00 pK@QĠK` p K0  D0C/A!b!b0CvD AT`PbJ2/2BL1#b0w?C"0C0ԃK/A!b!b S0 B .0 .0  < 0 < 0 T0Z 0 ?" ! 0 0 0K#K#KX0P 0Nj0 0(K0S#^N !V0J\ / 1V0 iVd 0?0 R ͌.1P0!V#K0u? VP 0 0Ό 2 >"x! 0  V0K#K:∛ Fh P0o P F>02lVK  P0SP@=00 S,KP\,K B@!L^Y; >KT2  Y4 `bFll0SP TrD0@BFLl R ?ohh A @"2 0 <2  r01[ Q h0oh  C0 0C0YP YpT 0H0 ^(KK `L20?K Z 0& P -LP 0SS2FFC`0 X?o20S;R,R R0d Sp0 x K:> F,lp-W t  ! t p  "F lP ^tp |  t  p pတ `x`r0FS 0S>S>S@d V9hʅ bph&lvpvtvuvxv|vvvv { `巁 p(KdKP ` V0 >SS 0S>S>S0@h0 T0K|0 P 0,S@0K0 P 0S, Kp dgn`h`aʅfxp l6p6t6u666x|& p (s;$@ `!#!U!@2U@@xPUpP p0PC B`K/P] F,hh0`Pt@ @p0p>p0 ` 删 匐 @ O@!2a11W`"%"Q20VN` 0 2Xct0剡  %K MP0 V  0 t0剑 %K 6P0 V@@ -@ p t x%Pp0pSt d| f`` `@ 0 JD Q@ 0@KX`  g>f΂0`@K0GS000ř0`P40@t p0 h| {Q3 -LLM@ 4 $!PL 0T00L 0:S0@/SW ၃L:`P?@58ʟP p0 0:IV0P/S ._vP T0.S0S/SPPP)+P< P@P#(K蝇@(KHYPꕇ@P0h0 0H0 ,0d0 0 0 $044\0 1\0 0 $044`0 1`0 0 $044@0 1@0 !0 $"0#44T0 $1T0 %0 $&0'44D0 (1D0 )0 $*0+44L0 1L0 @0d1SDPLPT 7R1U\0PS`PQppH,0@`0@X 1!0 @04$ 0t < 0Sx0 Q` P - l ` 0p 80 X j P@4 <$ \ 0W0R 001!RGpP0X0080`S00 D`lV04Tp0P V+@T S00t0L@00Fh^0 TP, ^0^ $0^^4Č0^S 0@p 0$4ꊆ@PlD0SL0S d 00LVS -  Q R0*;@0 "F,l R 0D"F,l  R 0S0C"F,sl  R$Y`H232420B RlD Rl ,`@   P0D0 \ :<0 6 PS40 GKV,JOV|h 28 00 hpD `80U`PUL &P00@SD40YD P/ 0RA 0Q-=<0`@0paQ3 @ R0.\ 2Š@G;F̌@>hYD 080D00Ddg1\ PY}0h0 -AL@0 ^`a0 tRE SQ0- 0-@L@j0S tK0hbdPP P@ @h@P  V 00 IxJI[I -`QLPV @ TpjX9f @@ @@@hFlFpFtFuF |KTpP 0:S  P `V _VLpg@p`rPT`V pp 2F"F,l02YhV\?\ lX>C- M X`P @ERf@TZ  pAHPSpWZЀX#R 7P pAHP6pWZЀR  SR00 ЍЀX pAHP pWZ SR00P Ѝ}pr@ЀX}pr@ЀX}pr@ЀXM@B@P@ -P|L@l0l`0 0`S X00P  0kP@4 vt;< l; -LxM1!0`@P0P(0 H 0S:d 0 S9PD!pK0 }|P-! pppK 0  Hh|00UP@@$ Xy@( Q$K0刐 S |t  ꦀ( 0XR $Kk7yꘀT  Ph|h<ش̴x;-D0D 00@ P000^ N( h P0P@00-SLP@ (000S 3/ e T 0-L PP@T0  0 3/P x @T0 -h0L0`pPe@P UP ^ $0p `@ d -L@Rp` @Ѥ@pT z% 8/P@DP -p0 0@L`PW $P 0`00"P p 0\00#Q0 P R(00k <D9980 -LM1!00P@0 S1向0 ` 40B4l1lq0< p00 #>40 T1<080 T U0 R7 S0# @T A@@420C42&42SV @-T(KS 0R0P3/02S04"R4 0T 3 # T 3R0`0`@S 8 0  3/02S @ <d8\8880887 F -LM `PQ p( ,@eKtK |@ x@ O0U1 >KPETAXA\A1 1  0{KQ Q Q Q q q  1 ( 0R$KT00] P -LM 00 K -- LM$ 0   0 K踜 0--LM0 K -0 0@L`Xq`00CS`0 PX0 X `Xqp SP UX/PP HX0X 0`00CS`0 X0X/p S RX꼛 H --LM$0 0 X K< H --L M( 0$ 0  X K H -LpP@ 4q0S000 `PP`s8P.0`VP C0 00!q  v000W8PJPB V: v 0 B  qIzpp Iz --L M0 0  K -- LM 0   K 0-LM` K|7PpPP) 2@P&   P(0R!ʬ0 p@ 0$  0,  0( 0 0K 0EsK@K}0000@ؘ , 0-PLp@$C@p0 -LP`@  u]P0U* , uTP0SW #uMP0U*  ! uDP0Sq   u;P0UY* P KTKRp(K ' u)P0U*  >  uP0S uP0SL   uP0SP KTK'p  uTX0P P KTKp s uP0SP KTKp  uP0SP KTKpP KTKp  P KTKp P KTKp  P KTKpP KTKpgP KTKpyP KTKprP KTKpkP KTKp;dsP RuT Y1` TKp P$R`0 7 uxP0SP KTKp> AP0Uf* <@A0 SOX0P- (K`@@`@@uGP0Sk C u>P0SP KTKWp  a\0P00T,P KTKDpuP0U*  TKd0 5pd0P KTK-pP KTK&pP KTKp@ B uP0SP KTKp  uP0SP KTKp  T0Y1!P6P KTKp 00B SA0@A@ 0@D0B Q$R uP0S!0T Y11PuP0U:P KTKpy  |tP RT Y1` TKpc TKd0 pd0Z$R0@ 0-L@h0000 -ML M? 00 | ' 0  1S0106K'&0   R 0 S '0&  & K p & / 6 7 7 6 6 6 6 0  夆 否 $7 f0S %Snf0 6 P6K5Kg>K 0C@ `6 ` 0DZS:=< Mo cqahW^hoH7x@T %T6 V 6PJ60S6  pQq p TV t6S 06 6S G60@0S 06 =K0CPP 970 0R (KFsiP 00 S*v0s& `GKY>K 0C @5 d d O(TaXa\a.xˠ^^K D PEe `, @ECKL0'e `Pf hP`f 0@&0@00iKP pʟf V F:0   v Ql MK @DR -K B    `RK&  &KQ CS06  =K 0C006@@S@Tm R  R@SnK`F0X  6 6 6 6 6[& F S& & %[R& & & P R& & 2 P@U/U 0p `@PEU R 0& QPEU  @`p80^ P 0Q6[pS 60S6 k>K0C0 pQg p 5[S 060S6 K 0CR C i.KC B@&N Xl 60CP6 ^=0P6 q E6f S-06K6s6   @K0C  㠦 m'0 jK gp- 0& 0`+0f 6 <f V @@P@Z@PZ@ P@60f V 6 6S7&`a07 Vq 6 6 FT eP HX 0&K@& & & & /& @*T 0 D R0@100 D R6 P@t06 6f f@C^KPE %mV76YK J07  7p ?F 6 !0f 6 OaTf V ) P X0& 0$5K  6S06 6`6 S j>K 0CCkKPiK L6 X &6B Q s05K6 S& P@ PP f V 6  SU 1& @P6&S707  0K A x V  >f %K: `[@Tf \ YnKEK̆ 0V &K@& & & & `F0㵦K@7 =KYK J 0Cd!.Q000 0L`L0S00Sd5FH dXکiKHP)& pd6S6S6&6@JT@T ڌ60S`@ 6 pQq p 6T0CS@+S&O\WPP p@DT0S 6 Q/@DT pʼ70P0@0  pQ p '6R`k 6PSd  p,8k^K0PE0$6 V W60C6 600pGJP0   Q  6@CT@T ڌP `@  T@@@T#TQP @DT0S P6 Q@DT 6^   6`WSөp  V `!6S6  7,K60pjS  6 pQ p 7@C6T@T ڌ60S`@ 6 pQ p 6T0CS@'S&|`ZPP p@DT0S `6 Q<@DT p:00P @ 0tp6x6Q6 iKP iK 7 P  7iKP& pf6&PCUUb0̫ pPEU R 0& QPEU p0<0\0P0 pQ| piK 7 P p 7S7&`a07 V-06K6`fS 606 66 6060RQ6 [SKH F`HC6&S07YKK P J`K   Q6 C 0@f < 0@LT@T`]PP 0@DT\ ` Q>@DT 0\.P  @  0Q 06 _>K 0C@6 0<  p66 iK2P 0&'P _.K B  Qq iKP piKP& 0iK P ]Q JQ/ miKP& piKP 0& R@`&  gQ 0ciKP& piKP QM 6[ pSR &!&j>K 0CRkK CiK L0  6?&R16 kiKP pviK ' Px p 'iK ' Pn p '&? 0R00 & pQ p 6S6  60S  6 pQ p FT6&06 60 7 P   `Q@_>K 0C@6 <  0S    60NS `Z6[m`@&̆ & F F F iK!P g6 ViKP pS% Q 6&  a06KQK Lx&4&@~& . S&7a`l0Fl7 + QM 6& a  Q aR MK @D ?iKP 8&0S%K- C+ S6E%K0cB SnBNK @D DV ˟ C0 P0BB00BD0\V 0@*N_.K B00^0DC0V 00C&7 R6[@/& F F F f"kJ@/& F F F fiK ' pPQ p6[ 'T 06 C/& 'f@& & & iKTP5& 0<`6[ 6 =K 0C0YK Jd` d~`H@ Q 6& a h&h     Q@ K_ A@}   Q& @ & ' -K B_@ AS @Pj>K 0CCiKkK A06@@ Q/ 6& a h&h@W  Q`a     ! Sn S01 & & & S( &S7&0 K7  A?     Q& @ & ' -K B_@ YK=K J 0Cd` 2>!B 0 0fd"f `2`Z>f`06K:700 ' 700 ' @Plf`%iKQP2 paĆ&00 ER0_.K_.K B BK0006 0 K AQP&0,`&[& g=K 0C R0YK Jd@7v Ц p @Pp 0iZ0  G`G 0S T  S00S0 i@P06Ц6 6dvHF6 66 6 6 3QR `' -K BHMK @DR 3`;R !& `@x05Kp0$6  RS 60C6 t&@dSPP p@DT0S 6 Q pQP@&  & ' -K B@ Qa`h&h S&7a`h0Fh7 QP@ K A@ ] Q76`0& & a7  H F Q76`0& & a7  9QP@&  & ' -K B@ sa` 0@P~^YK0 9%K J 0u^c@00L0F HF `6&0CS?6 iKP iKP& 06 6j.KC B p' &6R''  ' #000P @ 0pF{iK P& p-6X` 6 `iKP pm' ,x xwt8 s, q8miKP p& &  f@& & BiKP| p 7& `07 & -K B '  7& `07  p& -K B '  iKgPH p6`G0GX]iKWP8 p0 iKJP+ pS700 i7  K A ` XMK @D 700 @P%Q F pQ@ uQ K L& IQ 6& a Qf 6& a 6 6 Qw K L&  (HC>K0C  㠦 d 0jKp@J&0@00Hl 0 0& && YK JF dw7l 0 0& 7& `07  7& `07 @? S01 & _.K B0iKPj pF&7K A  k 0 0& i@00 D Rc`a`0 A R$Q&% R08 !`& 6   S01 & &0@00+&R @6 `olR !& `@6 6j.KC B pc 6@6 `6 7` 0& 7 6 6j.KC B pK &6R'  ' `66 K -LP@`R^44 0 PO^O -@P`pL8^0 P9^ -L MP`@0  pP| $ (Ko3  P0:ʳcK8 0 CK 0PzD R0S R00D0 40K0 K"P *z4` 46U0GpGVx0  D>P@.@>[<.<><@P<(.(>Q 00@P @ 0P @ &0 BP 00C@0 @@T0d0 =#KP0D@0 0d d0 `F0VP0 0fBX0 E0S0CX0 UP0 E@0SnP h0  0P l0 D0L 0C?o R2p0 @50R0BL0 L0@0CS"/X1< <R 0ZE  ! (K0ppC PA>< 0<023@` ` @x pGVApPU 0 T0 |0 L0 0` t \0 0@@ 0R?0S\0So x0S4@CNP0@6@d0P0 X0@) P2 X PRQR00 B@D0AX P0 lQ \0S | P  PP c PP hQnL \0R0p P 2 0`SyX0`0X0 0@P0 TgP0Sjd0S`0S\0S X0SAh0Sp<0T   h ` 0J0d0 l  @` `!00PP0  L  0@R@S\0   X XQPc D0hSQ\0!V.@T'ST0d `RP @  ?P Wh  7P  1pP T`  0  1 (KD0S0D0 ~0D0 _`8Q  T/ @010 $KcK @<  SM  d8`p$K$K 0 0`p~P $K`pH0PPP0 P 0D < 0\0 @0T 0t0 0S`0 P L0D S00R  R0| \0 |0 `0S@@T@ #K@(KQ=&0 !b1@ K6`0"0K<0 V 6p甀 < a@P`p< 唀 K0o`pd0S 46P</ 0D 6%`  5ARK80 `00 @00 {5 00P1 C)K0 \0PS`p@ )K6#K P 0KPU 08#KP R 0 圠 堀 ܃K  0 0P T   4 4p`,P 00PPP 0`pP 0匐圠@0 0\0 T0S]t0 `0 +0000PT00 0PP0@0  T( @00  Q 0 @(K0X h0 @0 B0cX l0 0D0 t0`0 `0S. jT0X0p@0 @9 a0 0 @@P   ! _pP (K<\ 0q2 R 5AK80  2XcK 0@PP 1P ( &ꌐ圠堀(K#KX@\X0@0X0 P00P0  K@0!Pc0 10 5ER`p !0@iKp匀  %0P@iKS< `pPP L \0R0p 0h0 01n ` sPmPP< QQQP`l | R D R R SP`lT0`@W XW  lPAUpJ $?aCoc?`(?yPD?('bH]?@$@@?(K(K0<0 H cPF @0P0C@0 - \0Smt0S`0 @`` P  00 DS0SR0`<0 D0S3 S ,PMp T< S- @ S9R0D  t ` T L00C0 Pp10@ 0 @ @+W '#K KP K0QPE < <0P K1% 0P PT0\0 i Sn @PS9U0D o`PUK \2(#KP0hK<0 P<0SK46S01::SP0@0P0 0h h0 R 0PS <@ 3p`<P 0 0`p0PPP@  0DSPD<@ P^ 0t0 `0 0L T0 R  0| \0 A00\0 #`0SM t@Tq 4`p<0 0 04@  5A BK 80 @ q pP( )K| 0XPG@0T D0S c0d|0<S D0S S  0d$K`p:P$K}P  @00 ;ꌐ圠8p P Pp P P9V5 `01`l T T@0R0D p<e10@ 0 @ _0.0<0 VT  \P t0S `0  T p<D0P`Sl< 9V`99 T0 @L00C0u t0o< P`lL00C0j t00P`l9V S<`<0S v`0!(QP/RQ//// P0-L@00 R@UP@0 0-L@PP00S0 0 R U0 0@! -L$M0@pS4 q@DP``180 P00 <0 4 D`  `@P H@ @ P0 C R0 R0 Z*D`80@P0H@ S< 0BV *0 S0B 0CRV@D:@4 P' 000 PPZ 0*!1R CV * R0C 0CRV@D:@0(K -LM 0 0NK0P.0 c 0 KL!,! T! P! L!  0 0 X 0 :R?K H D @ < 8 4 0uTx0 P -LK -LK -L Q-LP @T0 `P  \00@Q  R @ -L` _@PP  \-M Ѝ@- p@ P` !LNq` !@A -LM K 0-PLM0 P0P @P2`1$K0 BK0K0$c 0 ?B0 00/- ` -L @M0K #K@  Lp`K -- LM 0  c K  0-0L@Q r P 00 S P1 0PP   ! e[@0 -LMP0 K40Kn4`0 A Q@4 0 05V% 0S| Sl 4P8 pp Z80z0 Q# RL 0 0 b" p0 ?0SQP(K0S Qt0p0 Q A V0 !PPJUSQt  P 80 U ~  0U80jSPp0pP  0p    0P0p 0p Q=0S 媠 pW4Q 0P80 49J 80p80 &80p@ pg80 P80 S 080 1 0 p0 800a80 80@p_ 2 J0 px 0 p80J`p@0 0Q/ R  B / 00-PRSL@0B!R@ RP   `2 0@!R@P -LMPX l0 g?`0h0 7]0 p #K0@P \0 H < 0 -RB,@?>=<;:93210/.-,+*)('&%$#"  yX0H S X0PH(K ` @  R 0R0|0  00B S00  p@1T00pCTЈ 0B@ @00B S0P, d@ EQEd0|00 @P0@0 0+S -S0t t0 0@0 00C Q@P -0S@@ 00S 1CQ!@0C0 @ 00`C V@ 00A0`C V`@lQPtPa ` @ MdP  0 A0St H  S ?o20 dPT@U``! UK h D<01$CK 0KK\0d 5SRt0 S t0Sd0t %0cSGt08 K d PBPU0 Kh+1 0 KP#K'KK D0K8P< D \80`BPV8P   8PD P8P 0\A0S 50Q0 PEUw0 S8 ? 00S;< 0P00H l00S| P0H0 E`"0< 000R`0 0|0 0XS xS @ 0R R4 0|0 | .^ 0< @P H0 XQ@00`0SH00H0 R \ <6l@@K P @0P0C@0  P@0H 0@0 0l 00<  R P`P R@ T0 d@ 0C ^ࠃ^0t @`  S d Q0pSЈR0d0 R d0SЈ0@0 0U h尠!0TH0 |0 @0S@Tb`P dP60< |@ H0 80\ 0CD 80 P< q =0l 0`0 0@K<0KNPH X0@P SX0< P_0p@ L%bVP h 60"|p ` p`0PL465600 6L%ZK 0 PHXKʄ`|p`06$&!:%&?C0C0 VP#K'K 0h & 0`SKK0S @ 0 0S 1CQHd I0C%S$0 0H0K 0l 0 4K&P80K0 0I0|0 p0d 00 't pR0b0p0 ? 0 尠 @0Ph0 ;   ! bW<0P0 <   !VWD@8P0P@DPd0 Up00\ `CP0Ep`PQ0CPEP`PU00X0pSPE`FHQEQʒt0SV XdB0Pd0 h `P 0S0S/ Pd p0PppSpW 0Sp#p U !0 H0 2P(K)K 00 |0D \0#R008S 00 KL0KP K@P PQ @U<  !<NP< |0S  B\eʤ0 SD |P  BD E CW80D 堐0 CoX㩒Y Kx!x1_  K1K 1@PP 0R K P\|0S hd@@KP  0lH 0@ 00(S 0< 0000C@t0 0 `d0 t 1p H00Q00H0  @0{d0Pd0 / P+  $' N\0XV瞯<"A?+?( cPPi d+ 1P Up|TX 0P(K)K00 *h0Ph0 h80Ph0  P<  B\W|0Sa D \0 0R0D |0 ;<P< 8  B8 x0 0C0 s<0p|0 P0 H0 R \< XT0S0Q HXPXz HP h尠< 0@C\08@ D0 PP< |0S 80l 08 6d420 80R" 00S  S S <" 0< lH 00 "!Q*0R00 0c130|0< S  43,U h#h3PPK P  Ka 0 K(K0 KS| S=U  0P  0K00c0 pSP 0 )KP H0  0h尠H0 y Pe0 Khd$1 0 KP %XP h 4`0"| 儐 00L$&%&0 $L#ZK 0 P`FVK|儐045$&!:%&?C0C0 XP#K'K 0hx%` 0㨀`SKK@A<P< 8 D  B8 a[0|0 <0H  )\"000l 00<`00c0 W`000 S00 0|0 30t0  QP  R<|*8 0 00 8 a h)K(Kp 6(K)K 0P0 <D0< PDP sAK0'h0c 10 @ ,0KcH0K 0l 0 P ! t   oQʒ4 7R8 t 0o00, K6 0" P`h8t 0!0 K 05S00, Kb000H0K0l 0 P 0SD0 < Ls-0D0 00 8P 0QU!\0 00CD 80 H D0\ 0BS|0 F <u|< | 800C 80 | ;d X9Pbh K1 t00C1 o h尠$U 80K0 5P`e^U hᰠa |0S < D0S*0|P| 0H0 |0\ 0#R00S< 0 U`^*  0 RRQ0H0 `0S`0S S!00 h尠H0 \|0c0 h尠< |0 P0H0 080   0l 00H < T0!0H0  0H@ S< '!0H S0S000 h尠d0 0d0  B P<  0D@U@d@PD00D0 !0H0 z -L00p' -L M@ P@Y`PT 0@000 040 q00@P "(,8 80W#8 4AqU*@L @!8 8 R0DD#8S 00 R  001 (K@P   ! RR0`00 ` -LM3ß08 @00S 0"0@0 1 40 040 8040 @ AR 0AP0Q p`0 P@ R PT0 V-\ # 3Q R2 \0P@VJ(KQ`  0 \ L pL 0`  P b0 P0P  a a< X<PW< XR P0) @/oV" RH 8 00\0#03Q0S 0a @a0! W \' 0 X *  X*40 R 08SY00(K XR_ P0\ZZ>0(K@04S  0c1# )P  Ri  Rc )R08 0]0 \ -LMp< 00 4 8(0P`00S 00 00P 00P RX P@ \ \ P 0Y@0Y P0u X| R  B!8 PX pX ^@q 0D0CSڣ0SpPc 0X@0  0 0QZx*@` T0DS@I0 Q 0 T @   T@ 0CC10BY40DPP`%408 0S48 0S@CU  0S Sz Sj XP@"00(K0 @\PR @(K PP pP 8 @@ 8 +QB -Q > AP rS0J 0^\a 40X 01S  S  SW 40@PB``0 000T` 0T V 0PCSU40< 0P@0 S S0S~ 0p000 40b@0p< 0W"00 aF PeP408 0 S8 W@"00(K8 A IP @ >IQ@@8Xa8 r@V 40 0Sl Sm S @008 p<0 (K@@`P `D@ 21 2 Q`80080 P  \ PZ P@Q Q@E2pPLVD`X G` @218`40PE0@80 80`0C80 0@0 @000c00S `LTp0:  RLPD!@0S+0SM 0SI 8 =p @00`jUUEP 0@ 000S0S ~Pi `h4   BR"@I 1P5!@"@A \ _ -L@P`pW P  0 P  0  -L@P`pp P  0 P  0 0 00/ -` LBϠl\@pP \t P 0 WP0 0 V @`F`V 0 B Pp PU0E  0 B P V@98 -LM`$KpP@ K0  $ALŒ\ pP l z0 K-0AC^ 0S R0A  S@- *@@\@0L0C00Q00Q0  S  13S / 01R *0CPR/!3QR:// 00 00Q00aP00Q00A,00Q0/ \|$ 2A-R`P !! 1R31 a p@800^31: B B  `S000 CB!S 0000 R 0R    0B! -L M 0!S*0S @0SR @K@K0 @K@ 0-LM 0 P 0@0  0R"K0| KU00 0 0 00  00 00 00 K P t1-0`LVP@p Vp P0 Vpp8#8S@Q,) Q Tq% q/ @Q @DoV  000VppZ{W@r J@@03a2! ܐR!030#Ƞ1\-( Ġ1,̠ 02 00C#A -@0 QLP$;pe x S W$%R 2W@TXe45S ;ˠ0 A-` @CsTP` S \C^@0" Q 0A:RAS Sa  "bTd6d```p\ SL "0dt@2#  00@ 0V   0 ;-Lˠ0 CCSX`p S \CQ! B$Kk?R "S S 0RC,*`& GL$Kk+qX0h0378pppp@" $Kk,\ S !hx032! q0 L00@oW@X  ?t -p`HIL0M@ PcK)pCKPaAQP@PcKDKw K0 QP) K 0QP(K 0@ P 00 #KxSRCK 0SR@@ T`w(K K(0 00  -LMŸ P"KU U PĒB UȠ,Ƞ,0\@$Ÿ Q? ?#K4 QIcK"K`pT@P&%+'5`p0@@PZ 0`p$KbK `T@P LDOoUB@@!_ 000Up"K`pV0@ o1_ᩒ `Pp$Kq"KcK, Ϡ0\R0"K0b `p@ 0 ?q"K00@ cK`pQ [0b `p 0@cK`p(0?Π"K0 @NČ @n2Č>,0a(@ a31 A>42` 41 @ꐉhG-@P M@RĠ0@!#K@ @L@D@ @LTCЀ @ PARtB{d@P@@$\ ZL-Q-!@2@P @0PT 0  ЍGAE@P ЍA\1 \_  1 0 2 0?S`c? @@ @`6@`4& f.@ N7.74 00000 0@Pr@Hap`@P ЍGLZ2 \J' !2!0c0?s1A? IɠΌ i4Όɜ `4 , @5,50 !~ A@P$+4 @P00 o  0@ <?@Py!00000 0W -QLMŠ8 8@Š0 K8@ 0@p"K0@ E<@ E4@ XCcK`p@PcKDKQ!# L(CX`p7\, YLEQD$K1$KDK@TP0 UT  R030#(1R$1",! 020 0 C !0CÌ 0bA43"(Ko DKG@P(KC\0 $K\ SRL\*$K@VP*I1p?Xh? @Ό `6Ό6( h, H7,78 `p0000`0pCKcK`p@PqDap`@P< (Ko]Y+ \ $K1$Kh?x4DK? H h4  a4!, A5,51 $K1p0 @Ao_@P *T?@P|s@Pw$K000D0 0@0 `P/P / /B/ P/ A-PM O`P!3#1Q`1!2 L< a0<010Ca  0ZЍP0@- P!3# Ƞ1\P Ġ1,̠ 2 Cl AQ lL0Q:00 -KpT0WLUoJP( V @GOoUB@T ~W03@g0 L  000V`@ (  000X},} ;0$S-%L` S n@=qP R R#*Q03!:0!0C!0cR t0 V4 SRJ RJ*Q03H:0<!00C#0cV^7 ^;:@ @aA`a#!N@@  A ABAR$Kka^0 ϠR0F?o^20S $Kk0 0P3:X -;A0L M[ᡏS P⠏(@L UE UTO TZ*QP3X:P|!PPEEPeSR0 RK:0<!00C#0c#D!AT `pPC 0}P~P@?0S 0"K$(<,\R   KiT KRUT KiI0 눏 KPQ03:0X ;0S-L ;0S P 045S p0p ;S \0\ !;S 45S PNP  ;0S-L ;0S ?/R S 0P 3# 45S !45S ;0S-L ;0S ?/R S 0P 3#P45S 45S  -@@L<<1! ^`PpO No RQ1 ^ 0^P  000 Cn6 `a2ƌ A3ΌT 3q \lQ^<0 8 nCK$CK5P P:%ACKP0CKa K p$Kq! pK܄K0`4T0&&CK(ԅK0`p04H P0<,< 4 #K L@0P 00L0@##00 0PRK#K 0 `p ##K 0000P@ 0RLLL 0  (KoeCKcK@0`0* @_ 0(KCK@ NoX \ (KoCK@_0 L 0(K 0#K# 04 -@V壟Lo)DMp!@` `cK\`pcK# X XECK0"cK `0p @0 _ 0CK @?(KCK X=CKU (Ko0K QP< Q 3 #1Q1!1K 200 C(+0C# 0h0#8<0 8 h\#K 000 K0 QP4 Q 3 #1Q1!1 20 0 CK+0C,# 0l0#<40 0 lCK5$;%CK5:p5`@ Q0UVKEKL` K0 K4P #KK<0@P8 <0  0㒄K0p 0## X0`0#K .$DK0@TPW T0 R0@vPP0KK܃K%KT@`p#CK3 @P 0R@PK%K@ `&K\pQP##*#Km<cK0p"`QP#KKK (<G.@Q!080K P܃K 0"HCK K8 $DK1!0##KK0 4 K@TPT#K @ PK$K# R0t0EK R0@RPT 0EK @`Vp#3 0 @ 000``@0 0(K$KKSR`#p#: 0 @(Ko 0@ ? P040 $KS0RK00 : 0@P#K` -L) #* YX @P0@P  pPp` @`UT PpI`YX @TP D`p0 $@ P   -PL%@ # P P 00UT 030# D`p `p  -PL%@ # P P 00UT 030#SD`p `p  - q 1pL0`S3 V00AT  R+00 0PV<@T `PR x0皷PhV!@0 0D1S  $0煷0灷 ld|_ 0-@PL0 R xPQh00AKhrH `_<0 0PAKhRx 4c|b0  0#100/ P#8#4#2#10 0// / -LM@_ p ?"K`,!(1! V@P0 0S1`@`$K1P   ! Aspo (0(R8421S/ / 0-@LP0@00 -LM0SPP0@p@S0P80 D ` V*0  Z0\<0 &*@  X`^ 0< @P0 4 0 pp0 @QP40 X@` p@W 0JS 0:SpW80p8(K -0L@<$A QPyW@ @ PU p  PP. @ t1`0SrPP@ 0S 810$1+PU 0S 0C  P 0`0SJpP! 0 00 0'. y0S x0d0yW0S 80 (0R0y 0 _|H]4] -`塂0`@TPLڃ0TpP X 0 0X0 i  @ ^ @D@5 )  S2!:R@@D @#-0P10^$3 1\ : -LM@ P@DTpI 0 \H*32P >:0P80 4 ` @a@P 0  R0 R0@PVCK@P@4  Y  Z0 Y @P0I0C00RN0>HS 808(K@0@Ppa0P80  088 0(K -p`qL* 0` P00G ʔ V 0`8S # 52#10CV 0@ *S  LG cV2\# 053,1S UV@ S? -LM@`PpP 4$66X(0 , (K0( Y@ 0 C@@1`$K,KnP(0,  `, (0!30 (0  S@@Y0@ CIA5`$K0S0/0 R / -H1HALMP`@AKsPP8 pP20S  Q4 KLp$ 0: SZ0P   `0 $ ,| ( K FO000KF 0 F 0 м , 0-@Lh900CS00 Pf90P00CS00/y -0LrS. wS( aS hF00/0S +S eS%0S fS$ lS, xS0+S ,  0-SL@3  9 P00P! !& 0S 3/PP೼000P @ P 00 `00aa8@0`` 0,6PE 0P0 000-sL@ !R !P 0C 000 0 S /6 0-Q1P0L0@S2 0 SI ;000S? 0)$0 3/0P:0000P @ P V00< R 8000X  0@000 0x0PdlI_5P 006|E 0 @000| / 0-L QS :S0lB @K0hd0LB @K0hPE0000B @K0h6@000 0 0000/8 -L M\S`p@ CoR$塏 P $ (P ) SS (\{0᱀X  0(Q\ 0  P  KQ5$ 0$1$( X$ X $$!(1s(Q00(QSV 00\(1 ( Q\:0 i P(P0\ P 0 SX%XU!0SPC BP(0 qP($!(Q$ qD, 0S00r -L,M P`ßUL D  ` ! PH0 2/,(0Q00 0 P@ @@pp@P0K p< PB ^B  @pW`VV 0 P_ 0R@X"pWDPJUY@p(K 0 opPwA< 0 pPO 00  P5 Rp@!8  P8D`V VD V 0 @P1ಀYHpHp@ @  ohPH0L  kP @ @(KL H0 vk@ P@(KD0PJUH0  oP   =hP(Q`EV 1SU0$Q(qP $Q(1ճ@k 0-L@  S0 K0h C,0C00,1 0-LS@0 K0hwC00,10 R0-L@1  0K0haC,0[C ,! P0-L 0At 0@IC -LGM41@S5  e Q 5/p0 ` P 0qK/K p.K-K ,K@+K*K)1K(aK'QK&qK%K$K#!K"K8 P.K QKKP p`0!KqKpaK1K`0KKKKqKaKK1KK`=K0KKKpK`KK< Ƞ 4K KK0KK尠KGpEDDpFGFKpĀJ0I`EŀǐHpI0JF0GpƀEHD`KƐǀM0LpNO`pp 0SR`QPpʐ RDE`FGpːP 0< 8A/߯p^ APpM_Ām[PQ 0pgPMQ 0pgPBQ 0pgP8 Q 0pgP.Q 0pgP$Q 0pgPQ 0pgPPQ 0pgP U(K(KBO00A ,!a4 -4!L@ `PP/1S 0L1@PPP!R PMPP z!Rp qV A`_oRA`A`` 0-@PL PW0P -`LPP@H UQ0pP< UQPEE,!00D ^ ^ ^ ^ ^ ^ S `@  `@ SNA@RJA0@ Q0-LP @41S0 P0P0100+A 0 -pDLOMQP`, wm@P% 0Uq1  WK APr 0 pA`@P`(K EP_  0p '0 VF pWC qA/` ***!# p!!" "#, "$ ,( 0,$#4 ((Ƞ''0  0p't0..p!|.!"#" p!#|' "$!"# $%,,& +0 $#4(p/,x3 ̠4)*0,-p.012 D!74; !x!""#"$5p689: ?00@ABDEF G崜HL0)t..Ƞ.ŐpCCCC嶌 (Ɛǀp0!G!!GG尐 ) L A AAR!Hp''' C pC C C,BB))x)CCpCCR,BBZ!!!tCCCpCR.ĠBB`z `AP\0SXIXTx q 7/@ PL( '9P 1Dp N2ḡ !0 NV Q`fUQ0PP4Q$a$PP 圣 #@3Cp` p`(KTß pO`??P?ĠQD  < x8P Ÿ 004p  &? @ "?V Pj pR4 W qQ^ PŸH ^^^@4;P3 0uD H $ 0ePI*> 0BH,0<0(u ~pQP2V< zX!P00 p 84 p qD> @ >KW PDP OL0S 0>PP>@`P>P> P< x8P [>`>>>ꐥ aH -L M@(` 12f0pSP( p R!ءP. `0( a1  Y DD ,Z105,5(Kogꂑ P  0 " I4>0,ء(K 0-@ 1L3/,( R00 0-@LQ ,00 210U> 0 -fLMS`- p@ C>0@0(KX 00(K 0S0 00 @0T0  0S  SS  @ p 50 0 5 0 _PP 0A101$PP@ 0TPS 20 2@5Y85000(5  5 550 00 S S 0Kp %K0ZXDX# X3 2W 00 2!" ؁R0H     P 04:pH0:@ P w?w?Á Ñ 0 *P0j "  T+P 1S0S1S +0 29 20 29 20S 28 2)  KMP?P: ,ß  R0  " KK""$K K  R  K  KK ,KK,,KK" " K"$0KKK.|K.Ƞ# K.#(#4KpKKKK K0Kq &=O00P p !@(KS1S 1@ 20 271 @=00SK p 20 2(Pd1d! 0[*0X*<00<0S<`K M*P  G*`P pW0p!! 0 s< + +:0SԀ*0C~KpGK AH4 D4 @4 <4 [p@  p  p X (p  ( 0R Kh+0P7P t7@P7?0@0밀 PСȡ -LTMş @ ` ` \0   %00 RP_Y :Y b7 0 ` 0 QU(K w0QPY 1S %P䡄 0    {?p @Pp|:!h0 Ro  ppRpWq0 d0 APih0张pod0YT pqP0h0 0! 00B^:A.Z*L N l0 @0h0 !l0 B("811"ȇh  0P )0 #(0 0S 1S  R!<3 B00C S  )% Y "0 "` R"AAW !%T K0Pd0 d0YTp P 2  0 pd  $d02(00S* w0Q:RPXpK Spr  00D SX0 @0 @0KP< H0 HK >p]  X0L 80  80K4KP0 .0 0SP`KPP0  0P $pP; 0㸡d0  0Re1 S0"1!`d 0  l RZb {0![ $00 d0 9Pah0 * 0!{/Ⱐ1>06 0 ^ P -L$M(p  QP@`U ഑ 0m rp! ppp I(!8#8  pC!xS'x  ⇀ ^01Xp0!8#8B08#8S 0C8#80 0 S0081#810Q! B!(0 0S (K0 R1S0C1 0RX 2 0(4@ cK 0 4K *P (00(0 p0 0p WT V)1"0C0S4K 0 4@ 3KzP(00(040#[0!0]VQJ1!0C00CV Y4@ 尃K4K0H 4@ 3KVP,(00(0Q "P 04 K3K80 4 @P806(00(0  z#p000 4K4@ 尃KP 1 C  BV* "P 14 K0C00C4 3KP(00(0  K# F# 0-@LQPQ0 "P 00 ,#0 "P 00 #0 -L MP0 ,10C08#8S/0S PtwPoa V0FY S1V _"@Pb `V0ഠ p0 p0  "00(Kp1 pp J1!F∀0V.1 0p\ 01W 0`L08#8S 0C8#800\ 0 Ƞ1,Ƞ1SL "00 R 0VP00 00(K0(K"0(K 1 1 -LM@`Q q"00 26Y8 Y/(P, P 0- !`PR 10C08#8S 1 !0 B ("(RP 80 B"80S 0 " "(K3 0 (K0K  PP 0 pR1 "0C08 #8C R* P0 P  "0(K1 0C08#8Boᩒ P 0 p# RR B 10C08#8SPSP  !Y8 !80/o"y !{p 0K8p ! 6 P `0 RZ < Zs !뼁,Yj  HR!f p !뼁p X0HK S1H  `Pz 1"0CX00CQ 1X%X P!!1 P P崐! e! PU PpW0*` V!  `PF 0R H!  `P7Y20)80 7!802 0 < *! 8 P`, 0R Z !q W@ 0GS1<  !q W0G S1 j `P WR 1 BX%X XP!P1`p  L `P Q1PEPPEX%X XPp!  5 `P 0-LMK0 P K -KML M``PPß @ Op $ 0 @20@040 0R(K G@T R B@ W / P "200QB Q2?0040SXS02G0T Pp@ UXRP>  HZ@ p4T CC>K4  ;o0 W *0/S0HJ 0C/RF W0pQ l=K` 0C܄4 Pd dV! -ὼp"10S X `0 S00R0FX} T P100t4S p @jP 1@@DOoB_0K0 A/0PP0U4: S 10@0L ܔPj P R-L Q0P:Q:0Q: Kh * 0-$@L@!  K0h -LP\@Y -@S!  Kh薽 -@LdM00KP  )0p \p )0 ` )0  d )0 h )0` l` )00 X0 )0@ p@ )0 p Tp L x s @` `0XPH t 8@ < @DP 弃Pḓ帣HL  | @p ,lȠp@p Dp`pDp !8pa`pHp  " 0 `(  pW'0Q 4 R   P3 `10C08#80C0 2 P00 RpW 0p fW``0 R  T`p 0R ` P ` < -L$M@P`Qp -00W. 'W W W (00(KWFW! Wl WF0S 0S 4K 80KHX40尃[7 W :0GS(0tW,0p1! B ("(R  1p  BP(KW W% W# ,K0:尃[P 0 00p(0r00㸁(0= `p 2 ]400(K,0`t1! B 0("(BR0O ( O 0崀1  P 4K 80Kp 80Sm 43[  1 l P W #W# WB(0币@XEWF p SW[0 4K(KF%4 尃K4KvW (0币10C08(#8X 4 尃K4KaW> p $W  PE 0(04 尃K4KJH(4 尃K,꼁 X  lP) 0WSLqYG  [P H⨀H(4 尃K,p꼑 Y  EP 1ᴀX0C08(#8X弁XH!1 ⴀ   #P p0p l 0C( y각 0H⨀H(p0!1 p 崀!  P -@LP`P 0 00(0`00Q(0 -p@L,0$M@ D H0 1 PJ a`F`h&hV< < 8 Pp@ `Xh%XV" @H$H @  `FP h p8 0%0!01@0  @. p8 0U @EH$H 0#0@< <(K0D <0(K 2  U 10C08#8SQ[0D <0P(K 2 < PQP VP4 14PK0C00C @3K @P 0QH RD 0% 0ES1   QH @R0E[ S1X %P `UV 1`Fh&h T`!D   P4 `40K@ 80 cKS @PP 80Q0H RD 0G 0ES1C a Pd !0U B  BS9 qQH @R0EU S14`1 P ^ P= a1`F``Fh&h @T`P! 4FP7 4@=  ;!08#80P !1 ` `P! $ P0 @T0* P0 000/ 0-@PL , =@ (P% 0"0dY -L,M0@(pP  "< ` $08 @0 \0H0 00KTp L0 p 08p8` P`@ LD0 02` !@0`!@0 D0%8f#" ,"  % d! d!,H <P  2l0 ? 10 !>2h0 ?!1 `܌K`&0 %K " 0# K E?K&K "0#CK KA?K ܌K ЀE?K``&p'eK̠Ì ̠30 C?KmK  "0#nK` p`pnK 0p0S` K-KK.Ko0l0 (0 /K(0LK0= 0 KdKJiRO`܅KKK܃KoKeK K KeKdKKKlKCK$Kl0 1t Ġ̌| p !Ġ ̌x gKGK@$P%MKIvp q~#H,p 3l ܄K(w yp (yQI^ wP p VmK`&p' @P PNKK܀ ܄K@ P)790 )970 .܉K(K  !,à)K " 0#.K,KD @ @P 0DK@$P%K`pKdK p` );40 ;40 (jK.K`&p'dK`pdKeKP@ 0܃KKP% (@$ ( ))  K ԋK 0 K !KKԍK@PKK@P ܃K<30 <30 ܋K.KnK`&p'@PoK`p(`) p,Kl 0@PPXK܃K#K dK @ PK!DKEK܅K@PK܃K"EK@PlK`pCKC%KfK`p@PdK!%K`dK!#K`"C(K -@LQ PUP`  0pRPQp b!p !0P0H @ KhR Q b!p ! -@@LP `YP7 md0! 0 #0#0 $P H P0Xp【H【 a $ QPP$ UX P㈁4$  0 #0#0$Xp〠H〠\` P   v$ QPP$ U R-L  -L M@P 8PH8p,`KI KU@   K 0-@PL 4@  P 0$$0G R-L F# -L M@P PH(p,`K KU@   K0-@(0`( "$`T"a! 4a# 0/ 00-,PL`Md0 ` a P 2 P` dP *P `PF PU 0D @0 1CP =8P 2P$ 5P T3Pu 4P?0$  00` KDK Pr K0!P AP P PF P" 0D @0 0\ K00DKd0K p \ R K0[P1ZPsHPsWP  IP} VP) 0 0P P P P 0D @0 &P )P| 'P (P 0D @0 8P Nx8P; l8P 0P0$P 00` KDK' P`0\ K00DKd0K; p \ K0>P=P:P/  w;P <P0$ 00` KDK Pf`zAPb'aGP ^EP,[ ht T^P OXP YP!J | G 0D @0 R <0 D @ ` O 0D @0 J B0D @0 E 0D @0 @0$ 00` KDKP .P 0P+J P P P0D0 @0  >P P P7 0D @0 qP wPd  P) 0D @0 c#P~ w$P %P ,0D @0 VP P 0D @0 P& P &0D @0 B*P +P D0D @0  P7 P 0D @0 .6P 7P0$ 00` KDKEP  yP0 @00\ Kd0KDKd@ D @ Mp EK ? <4P 0D @0 P0D @0  DK㚫PvD u )0D @0  *0D @0  +0D @0 y0$ 00` KDKP V 0D @0  0D @0  0D @0  0D @0 DK_P : 0D @0 J 0D @0 D 0D @0 ? F0D @0 9 G0D @0 4 0D @0 .0$p 00` KDKP  <0D @0  0D @0 t0$ 00` KDKP  (0D @0 0$ 00` KDK}P{  0D @0 P 0D @0  C0D @0  E0D @0  @0 D ;@1 R 0KP#DK \ KD @ m p0\ 0  %0D @0 0$ 00` KDK8P  0D @0 0$ 00` KDK&P 0D0 @ 0JiHxH ZF$EDBdBAL,AL@ -PL`pËUO A@0S Q@PA VPF l 0S2 EP0 W`= @ 0S: 9P8 pU ! 0S01@0@V 0 0 W 0 0  TT ᅹs V@W T T q@00XX j X @ $ Я  0-LI0@T 03/@TpPP |00@T 03/@TX/0H00@T 03/@T$0  Ԯ P -LMX@@P K 0K # K  ZpKh -L MPRa@p  = 0 S 2 M SV:  0 0S6 0 0 S 2 / 0Q70 k 0 0(K  00 0 P 0 0(K  P00 (K0 @@ 0@ (K 0 0ꥷP  00᜷P   0-LM0 R@P Q \   \0 0 \  R0 0 1K3/K0s?0 Kr?>P10  0@-(@ U1!^  QN \SD0L00@-(@ U1!^ P\0PU000 -@`LM ,KP (K(@p@0T!؁,H(@T`1`! @D  T(@ p,  PP$K$KpP p@ -LMq00K< D PpG@0 0<0 x PU @<@P U`1`! 00 0 80 EX80D PU0<0 T (K(K -@`LM $K K}$ P 0 q @pG P@D @ P$P TKK  KP/0@ 0A0SP*Q:/@- R (2 R R @-PPPP RrPP B@ PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B /R0q0`0q0`0q0`/\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R0@/ 0-P8LP@04 02P*T 00S84 0`@2T:0800 -LM2Ÿ0 P@R0p`00 Y 00S80S 00 Q(K4P  ~P8 01\ 40KK`0Ġ`☠K8  0 0 ' R= P8%YD 1 c1'à40 0` 4`V 08  R88P@PX`002,"SR,BT  4"R 00_"00820 0 R)(K D P02,"SR,BT 42S>?00 c/K8 02,"SR,BT 42S$00 !Kp 80Sl XF³SP`  " 嵳"P 0 S c/KoK0 `w42S04"000@ 0~((P X` `0((\= 20S P02,"SRl,BT wKi02,"SRf,BT \42S00QX-028 808 `0 R`SQ P408pH R48 0\R408 \P0` @ tUY@B`@ T T 00S`㡰<2P`R ` 8@P@@ wKL@ E{@ :02,"SR ,BT 42S@ "ꈳ PĞ . T Ș -P`pT@L@M`@ 峄0 00YPᨄ(K -LM@ß@ P@T0 @`ISQ? r4 rD 000V``V20`V`0 R2`0b ` n0X@ Z ! 1d@T X Z:0 0R(KV 0 4S`RU @@@V 04S:0`S0qKp~. A Q @PPK |*00 PT  V@7`p W4 P &V  RX( QP 0P0 @ R R0 p0``~S _W` `pG`0``Y~``Y``Y`LKVQ@q -@3 00pꊲ P 0@- "A @ " @{ 10-S@LP  P 10 2 0! 20K0hp@-@P` VP p0-P@  P 0S RP0/P0    PP0/0/ p-LM 1 0 @ R 0 ^0  0Q0KphK KPUP*`KPP `K`1E"F0^ R KQQ*KQQ  R 0RKp ݱ0 P -`0L,M0 "!D  L  H cL0040  P 0 pP0@"Pp (P@8 a86/PD6/P8p6/Pp40S  00 H0 X@ <0 :pH@ 6/PPXT 8@ 4P00 p Xr: 6/PU UQ 00  S T8P40SJ 00P00HX@*@0C00pG0A<S B@1!<0 0CS RoQT00L*S*SY:@00@Cn 0L H0 j 40SA<0 00 < 00 PD0 0S 40S 00 0U0@08P C00pG0B< S D1!@D 0 R000 Sp*S:0$$40S <00 0R000/RX @pHP40 S0E PQ @0 CV40S H0R0000S0P40 00H@ ᐒ"R8 *p4P4p Y *00pc0 0 Z p 6/PU U 04  W  Z p00@80S(K@0< C00pG0AS D1!@&40S@0 Cp0U!6/P8p6/Pp<D 0 R0<00 (00@ <0 6/<0P 08 @0 86/P8@ 6/P0 080 <0@G6/<0P0P0 b6/PP06/P0Ppp@0@H<00<0 6/P<B6/Pd6/P@U"! RQ @0 C!10S D 0 R0P D00SC@0 P @0 @6/P!6/P@6/PP06/P0Ppp6/P8@ 6/P0 080 v8@ t<@@0C00pG0A R-L Q0P:Q:0Q: Kh꙯ -LM 4PS@  $3/pd0 0Q P p厀4P4S $ 3/ 000$K0 0 4-dLVP:@T@T 00 S   00 S   0+@P`0d0p@A -PLMK`p0P$0: S@P +@ 0 0S t K0 dT K@00 K@ K( $$4/ 4-s0L@P`0 }P4 $ V0000C0  0R   10 00  0% 0J H - 0RL0L0  0 0 S  A 0 -LM4PS@Aa0S-0S*  TPd  P0 00 P!    0    0(KpPK $ 04  0 R 0QP3400 W$R P4100@000S0p pp0d 10V0 p0 $ 6/0(K  0  0 0O 0 A0 000/ 0-@LP  0R 0 00 5P00 0-@LTP @T 0 7p0@T``0  0S S/P/$(0#   @// / //// 0-LM @K $ 0 0 0 h h0 0QP00S 3/ |8 T -LM`PpK00 $0 00K,@ @ (0 (K P@ Dw @K -L M0SP5  0S p@; `00 dT BB Q  x V`! V 0 0C `@0 p`@V` T `0p@0(K T 1+#3/P0p0CS@D0 ,0Tp@R- 0 T!1 P`#3YQm R~,03/Pq00 0S00  Y 0 p 0CS @D0 `0T @Tp  00 1P @ 000 =Pm s R*V * 000P7@D RD,03/P,`Ve*`C Y:ҪP   I0`0 `NdP 0  000WP 0 @ (K  0 B 0 0|  0 B0` @0- 0 8 0 3 0-LP `V 0@0@DT`0@T` ,0 3/Pʼ0@00D0SKh/ 00-@PL0 w0 Px0 0P0, @`} PZ}0 0-L4M @D x>R@0 <0 80 40 00 @T00 13"000 , KDKP,K\00  -@0 DL4M>RD 0 @0 <0 80 40 2K1, ", , KDKP,K500 0-@L⠛K0h蟛H-M  0ЍR- S 0^   0-0 00L0@S! 0  R 0   0%  0R0U0  00c00!0 P @P 0 0 $0 0<  -LM@Pp`pP  K/P04 :CoR  S  L H0(0P   ; 0K; 0K  -LtMR"P`0 @0 C 00  0 0R(Kx K|K0pZ |ᠧP0 H"H2x 0Q0P p APP0000S!pK @ W Pf F0B/SKDIHGFE9CBA@?>=<:9876543210/.-,+$)('&%#"! 0 0 000000p 0x0 0 x  倐 00  t0K0?t0SP| p,IP0L PT p-L M@0Pd{00Ta!|V( K,|0T1S O{0T1S |0` |00UTX1\1S A{Kp\1 |08{Kp0UX!\1 0X!\1 0-P@0L%{U0 \AQ\ X10CSX1 K0h{T1OD{0K0h {`{00 000S/  -0 00L@PT0z00TA{T0` TAT@ zX1@0X1{0T0`X1 0 000S/ 0 000S/Q 0 000S/  -L4M<0< 0@DK00  0RKZT P ut,@ -L M@PQ4PKT0@K 0 00`p`  QQW QV  V0"`"(K V0 R00S `"(K`(K`(K R0 0-LM@,0,0 @@@K0 0-L@PP P _@0@0 -Lp@P`P P HP  WP@3*] "0@0X 0@0@Q 0@0Q:// BQ:// -,1,0L000 A!@00QP P`bP 0 PQ 㼐 p'@P  ! 0`R Gᵧ@V`@0@S 000 !B B!$Kk v lvLvu 0-@PLP 8P0U0 =S00=S0  0-8@@@LPP0K0hot 0-LP@P 0$ P0H00xt 400-0L@P0 P3#0Dt -L M10 000 @pT4 _ `P jP0=SG @PT40SJ @A@P P)Y - R@`@@@R*Ya2   呤`P, 00  D!  00 0``@(K00 YpQ1S (KR@`@`PPl L|s srr 0-L@, p  0@0000 L -Lp`HP@PP  bP$00@0( L ,0-Lx@P0 0@0d ,0-Lx@P0 0@0ld ,0-Lx@P0 0@00d -@Lp P%`e0:0 p-L M0` @P 0p 0 00 QP 0 p: 0Kph^ 0S0< Kp -L M@p X0 Q0P:0:0Kp g0!-!0!Q00 000000 0#0, 0#0 00!R0Q0 0R000 0-LM@1S 0?P"1$Q 6Q 0  T& @  @1S 1  S( P  P    K0P q1K0hg0000 0/ - ULp` QU @ @E 6/P@ -TL`ppAT P PD 6/PW PPGP -TL`ppAT P PD 6/PW PPGP - @UL`p)1S P@@E  7/P/@P@@@@UE !0Q000000 @P @@@@@@0PpT1S   0 0U0 @0@0 01 S Do @000@@1 01@0Q- "!RP 0  \0   R 0P 1SB0S  !0B0C  -PL@T`0pTp  PTl 0W0$Kkw\ ? Rg   T  L 1S Pc1 Q Q0000 Q0 Q0000 0#0 0#0000pP 0TP000^0R" /o"!T0#00#00!0 00`0T 1S T  p !PRPPPPPP㗔 RC/A 0\R#R! R/R00 B-` PP5  R  ` RgJPe P 0 0  00C0⃑ i`P5I 0 038P0 0C0C P 0C+P:H RJ@5 5IP 0 0  00H0 SP RZ 0P@ < 0S085Y3R0<PR4@@PP&rR TP @0!2P4@@@ P5`P    A/@- R (2 R R @-PPPP RrPP B@ PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA -L,ML1L!0`P U@0  XpY U< 0SUD0 0R7(K0 0R1(KoK PKY P:, K#<P$S X $ CY ,0K1 $ S0 P, K!0$ R00S ԢL PD -pL$M BW"RH H P@P-T`k +T@P00T W  ?X#K#K#KKKPOKQP00 T00SEK4 `00 42"< R0K@00D  R@a0DSW@DA0DS97@DW6v $KKXR%KQP00 T00SK4 400 `2"< 0KP@"0 01`#K"0 01`#KZK V0EH0 H00(K0Z0& H00(K 0 p#KXs #K(#K#Kiq00XS00 C R @ 0P#Kp(K A BRWI 0p#K ?? K 0 0 0< 0 000/ 0</0 000/ض 0</0 000 /ᔶ 0< /0 000/P 0</0 000/ 0</0 000/ȵ 0</0 000/ᄵ 0</0 000 /@ 0< /0 000 / 0< /0 000@/Ḵ 0<@/0 000/t 0</0 000 /0 0< /0 000/ @0</0 000/ᰳ h0</ @/ /H-M 0Ѝ -Lp`@P7. @T0P@ -o@ "P! #L0TM R0"@(P( 0! R0$K  0S RP/0    P/ -LMQ@P Y8Z J (KXY/ TBZ 6@ Y 0H @Z00 X 0h0?o0c5#8 c432<0 ܃KZ P @(Koo?o`FV` Vr 0f"ZN (K0I KZ00@i o`5/o?o B!` VK VC 0f2&5p ?@P 0?40 00 #K @T 04P`V 0p8 < CKZn   (K 0 coo?o`FV` 0f4&1 @0f4à1 KQm:/P3/1o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ / 040-L@ P00000蜷E / 0RR! R/-M ЍQs:o Pj:o?o 0C͏LL0/P1"@ P1"@ P2"@ P2"@ P3" @  P3" @ P4" @  P4" @ P5" @  P5" @ P6" @  P6" @ P7" @  P7" @ P8"@ P8"@ P9"@ P9"@ P:"@ P:"@ P;"@ P;"@ P<"@ P<"@ P0"@ P@0"@ P 0"@ P0"@ P0"@ P0"@ P0"@ P0"@ //00/00///Q R R  // U /Q R 0 000/0 0/0/00/@-Q @ S Q P 0S Q P 0p@-Q@`& T^% 0C P PC@DUT QP PCUTQ pS@-Q S Q P 0SP 00Q / U /p@-Q@P( S(  P0C S @ `QP @` 0@0Up@Q @p0p@-QP@`# S\   STP P Q@DPPQ Pp0U0pS @@-Q S P0C S @QP @ 0U00Q   U //q 0/00/   // R S 0Q000 0/0 0/0 /0 0/R  -/R S 0Q000 0/0 0/0 /R S Q 00 0/0 /U/R 0 0/-P0 0 0S0s R S  0 /0 0/U/0 0/ R  Q 0/0 0/0 U0// 0-LMp0p 0@| 0PK0 00 0 0 ߌK 0RK0诜ܢ P0  0Q> 448A0Q" QQ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠ ̠/ Q ̠ ̠ ̠ ̠/ ̠ ̠/Q0//Q00̤0/ b0R0̤A0QQ/0Q0̤0/$ $0 00S0/  -L -D0D 0@L0P p`%c@`긠 //////9 // -L4Map`PU@  FKg1 0 0TK(L@ T KP0 7/(K萜0S)  aX`  @ 0 0lS0  0 0  0 p0`00 x0  0K0 t 0 0 @0 ,0K c  `@ ` "0<0 0 0 0`SP tE  0 SP0[ HT` dOȡ h0 00 0000 00@00 0+0 C0 P 0 { ` a000 0s0S 00 0m0<0 0h0 T500 0 0`0 `0 000 0`0< , 0 00 `p0 000 0 0`0 `0 000 0 0  `p0*S 0 C R@0A@0 C R0  S 0 R @,0K c L  U 05 P2 U#3x 0ZŅPP Pp0A U5AP2QeA U 3A5P2QRR R 1> p`0 0 A0A0RP 0AHC D0#0 U0E000 0R(K0 [0 b0 s0 0 @ s 0 `0X0 80 P0 0W @ S 0 `p-0 0 0 0> @ : 0 `p ` 0 `p0 0 ` @ `0100 `0 0 @`   0 `p`  d0 `0`00 p0 `a p0 ` p` 0 `} 0@ T@ T0 0 ^C P -`X0X 0pLP@PU J0PES 8/`uX@pW舐 8 - 0LS S S 0R o 0R0 8@o -@L`p0@@P@ И( 0$ s}Pd HP -MLMA@P `X p0 n0PiX40 0PR.(K 0CKEKJI 0 0P ᒘt 0d 3}L0+0 \4 j\4  4Kj5Kꏗ PH\v -0LS/ S+qW( Y%`P@ U@  0S#0P0S0S 0S0S0S  P PU 0R0 ^^Î ^@T @Ȍ ^ -BMLM00T .TX%XD U@ 8 <$ PE0 @`* C~KpGPU%:0 00~]P@ V:^^84<$ @ZP@OPD40 0R(KP P -BMLMp`TT T@ ,T @XT 84 EX0 A 0R>:0x0(S 4"48C8U @40 0R/(K0x0(SX%XUPE CKI< @V:]]84 0 <4 fP PU:00 0 0]Pꈖ$ P -nML Mϟ&    0  @T 1S 0 S`1  ?@ X@00& 1 @06  >6 0S6 S==K0C☖ @voP pR P* p CKI  D ^P R!Rs P YPʔ6 @0ᘖST `P6v PP0S`V6@  ^  0S <& & X- @  & T06 06 &0& S63 6 d1S0` t6 0Sa S006 1&021=K0C6 =K 6 AT *pgnKg^K`FPE0P0& 04/P񏐚6 S006 W0d6S66 66 60SAT 6@PP PPP6qw 0;F ەPl6`S6c  ]`e^K PE@E~V  `=K 0CC6 c>K 0C6 ?` 圆 L  f :fnK06 : `F06 F 16cK FH0  0 p PP U0ڰ& Q `1  : X0 0R  006 $666 6iK CAR 0H@L9/Ci>K0C2`E)b!lv ~PL 0S P  6 @06 T606 0& S& 6S6S m< 0 x6&0 Q](KpW A6 00liK6A C   6 P6 `1  x8 X0tQ7  %00 P0`1 g 8 X0VF6t6 0S06 f00 PP @ 0P _ w  &P7@X@" 0 0R  /1 01E 06 [0 CNK@D 00t 6P&0&h Xy0@+S .0CS(   0K %ꘖ 0& @0 !6Pp0 t  5 X06q_Q @U`D CK @cKL01V6 6 p06 ڤf `#& v@U D 6@ S ` fU CK A6 Š6v`160006 06  d40@ X0 +06 0{ (06 06  #P0&q3 @Xx0 AQR RP e`1SH 0   R0 6 6 T OexV  R[`!!! QW   2&@x&X0Q .0&RC A .AT` *`g^KpPE&tPp 04/PQ2N06 /@2 X@ 0 0R  .`V AS06 1S&06 60S1 S006 06 1c~K06 x1`06 pGP1: 6 幂Por00&nPX1016eNK @DPD cKY H]K PE H&  i&b 60P+06 0 P0D )ꨉ PT@Cx<p` ij4XH\pP TP B("(R D0D P 0@6  g c6Tx6Su \06 t 6 SYVE0 0 0X0(6"( D6 P TP B("(R D0D 廀P06 h&R!6 0Rj 0`1 z 1 0XP0V0   -i6 X㰀U  H("(R  T B("(R D  R,#wP l2|@ X0x0`! 6S<06  t&0 o 0 j 0P 06 \= 0 X 0x  i0 X3 @hX5w (06 0cNK@De.K BT6 ʁPrP 1011S1& 0  4 X006 8_06 6T0 6|_0@+S .0CS Wm O2/ /M-B  (0<!`p Q1`ep6`Ѝ/ɚ;M@- ",A@TP Q`p A `T Np`@Ѝ/ʚ;0-M  R0@P0 R0Ѝ0/0 0CSЍ0/ 0-L M$PK@㷀PK04KⶀP K,0"c110K000K0 0-@L0M-  2a  Ѝ/M0@-(@ N Ea0@ Ѝ/Mb -AML Mq1p0<4 0@$ 00 P$ d6vPP `CNK1`K+0 P 04[S ! 8$ 00@ 00@ 0Sӭ<40 0R+(K`hHP840 @S 0S0S 00@ @@4@C b @ᣭ 7 r P\ -CMLMp03,#8 0 D$ @P@ 0 CK0`010<4 0>000 P^00L 8,G Sb S00; 0 ```p 0 P0X8$ V8$D400Qz(K0 @t00 ; P0 <0 0;  PS h8$ 8$8$ V8$ 0P2 P: P3 V v4!48C8S 8$ 8$L- 0Ġ"Č$#$4!4 Ƞ,Ƞ(8"(#8tbV ]V XV ~\Hp PP$@ @̦Di -AMLMLL pP`0  R; 00 0Jt{V@ v@ P,0CK`@0 PWG 00 00 0R(K PP @@0.SC^KPEL0 _,0K@dD0  Ul P<TTT - L@P`~P Kh< -CMLMß P p8$ 0 @@ n@U R/ 0.R@ RW S5<$ %.0B2?o121<4 5T! <$d1`0T010#S<4 ` 0084 LP`V @40 0R(K<$ C.K2 BPw<$d1@  R<$ 0s @D D0RH4 m `Ld Dd 0S? .S: 0084P.0=S 1S. S< S1 T0 xPD4SRL4S CU`lLd Dd <4 0084P0S`00SL40L4 0  H4 RH4 D40D4 <4S0<4 Ld Dd 008$ 0m`<4Ld  Dd TaT]0 084P@TN0<4 e k P -LdMP20`@po W00TY" ! x !DŸ\!   / ̌V|@ x  Y V V (KW,0K P|K0  0 GTP0P (TT0V?o2``VPⴠ  B R,0K0 B 0SPP TTT{T P⺠E(K 0 >' ' 0 hr~ 0 pG R0   ZT VT WT 0 NT 0PS  v 0P<E0g <ܝ -LMpP@`/@D T@/)'TV  T0T T 4"40(",4@0$K  0(  (\ -L@`Pp帐ἀ E0S@P0WU! SPS@ D GSDě,0`( "4`43MSZ1S Ѝ/ -LM0P8 4  @$dt各吤 0`p 0 S-0 S S   P%  P2 P]  P40f z0  SR 0  SRS(K"d1P00d10d dt\q"P000 @Nq 0P  P  P)  P&090060 "P000 q|qip4  q0000:0@ }P ( vP090|090x gP010n  ]P020d  S0P<0 8 RY @?P01?0# @0 806^8 @00< "E4 40P<0 8 R: @p?P01?0# @0 80^8 @00< (#& P @  P010  P010 tlbH\@aTaH$0`` @@( p-LMAT ,K*{,0PK0%  $`0` ,00 00 ~a{Ka xKp@@4 -L|M0 0pQ U( ! Kz 9[$`K0#7f @KW7 Do J( 0 [R KPPX\ Ph -@LPy 1!01n0SPpuOPp yp0S 0-@LP x3s|3s  01P 010000hydy|3s P //gP //ᬔ -L`p@>WP0PS 1S   W00P0S@ -bML MPd+d; $& 0@(6 000 dQ0T (;<+UNK,`05d! 0  d!.`1111a0 OK;P 0? 0hό,6 d10d1 8 8P ``@ \`0D@S_aH l S\  S S00 Q`@ 0S S R:0 0CS00S00  0`9`0o0P6 I 06 89CK06 ,90f 0<6 90D6 B>K 0C46 ^>K 0C6 K 0Cy0%!xx|#0 & &    8&5    w`0So V `0`SH`DHp .S`0SVP@ .MT00`FV0S 0 fP % N(&00 0Q0O(K 6S460 S S pCoSrpW `@ X[_q Pp`0D@SH  \R@* S S00 Q@ 0S000 0CNK9P.P `[6`  1x#|#r<DQ (dD@`mQ 0 SQ, tOL Z46D`@V H T T@ D/oT" ;T@@TU@T t#$6P ;TM  00@@TV  Pp  P@`/ @6 ㊁Z~<yPD @@l`@-46p@ T T@@ @0S S 05 f @ 5 H1EK 0@ @@@@ ?86 P v RP 6 v R6@F `pPX` 6@2 ꛇY PeԒ BdXHct<LЉI -L(M 1P 7؀@aYX@ T 000 $K pQxp  T000 D0KuPT (000 $KDH -P LRP0@p`  o0 P  @R0!R  R `  R ` $0$00-@Ll0 6 -@L,0KUMA#X P HQU `΃0Pd1 0 P0 0d!lA \! Q/KpA h! T T! PFpP XiP 0Z`1 `!Rp\Q0 0, K !`F0P\1 #ZHT!0 PPT 0H1 Z 0 PlS X  I:0CS P A:`C0K pTA @R7  q Yp`FP!p0ZTA" p T `Fp Q?KT p P1   `Fp W t P1A V*T 0d 姅0P0(KPP XP `iP0S~ 0Z`1 j@0P1 {PU\A n0`FPY @ l hQ  _ @`FY #T XX PlT1Pd!P0 ER*\1\Q p1 P1`1l1 0`1 *HQTU@C 0  0Xd 09 0d P2 0-(0( 0@LP0<000G L00/ 0S > 0 0F L 0-@LP00000 0-@LP  0 0 0-LM@ 0K    P0 5P EPP   0 K0PK0 0 ֢ -LM`1`0\!XQ Pp QpGR`, `GUp5 K A@ghP! 0ahP 0S@0S0ShP@  `0 DK| | t 0 8KX X P `0 +DE PTȇPSH Sx$R 0-0PLU# 0U#0PUP!q@@0``F@0P  $ 08 P 0E`1(`$ P 02~Pt''8 -L$M(('  78 G@7 `R 0P$ (& 4 & 0 < SF &Q  FTڠ&(dp0CS,('#"  06 0(0$&$ A@dP(P@(@ 0P(0*P^ P00Q@40P0S0S 0SiH6S 0S 0SI S 0SQ 000SP00 5 0( 0^A02* p! PRL C TA X\ $ R$4 0@(SPX( 1  S<80  \40p(PP(K p Nq0001RC@ 0R*(0S000P(03 0R00 1d# (0\8<(0=(01 30 (0+ (0 .(0""2 0  (0 2 0(0"2 0 娂 0D @0 SpS (0 x2 0(0 d2 0(0 P2 0(0 <2 0(0,20(007S 0S'20W 0T *!1 0P1(<p5 @(41R3P1SSX!D@0 Q0C @@! 4p  ^P(K1j p  3pP  0(PB p@X}L},}4dT|4P{z\0yh<T<$ xw KT|G-10 ! M X0*00@ < 0 o_^0 R  \:Pŀ 000^ R/YЍ$0 0 : @~ ~ -(0(0 Lhe9 Ho -@L@`V 0 CQ𨝈Pq᱀P pG PDP 0`0H -L@00 R ^^ ` P`1PP0 0D@  $  T 8 8 0-@PL0T  0S  T0SK0hIGK0hCP@-0@ 00d  0^,0@01P(0 0$00`7 @ -L@`fPH ` 0(S  1T  0 $000PP -L`0P}~@P Px~P 00~ - 0@SL`@  P 00    $  DPP$p0S 5 ` -LDM: 0( R@ @w * `< *: @4 0^_H0 <80 0PD` `:P0 p?L ω00 80 04SpP@:Tń 000P0 @:TU-9y0P9p00 \0 LL D0< IHS  !$RQT) P L) T D) X SdT T ( 80$ RD 80, R9 ( 0S  !R 8d0`  @` $`< @c\H?@$`P 0!Q < ȟ A  B QP'@ X , '@ $ GH<@,0 0PLP8<0夀@P: @pPD`d0S*\'0 0 0  <' 000S:7@ B0@<00(KA(K(K(K(K60  260P0LP(KP<0 0 a0I, 0CR Pl0 $0` 0T0  0,  < ^ 0* S(@C\h@ Tn%<0 00C?00(K(K(Kh@\ AR` a, R$ hQ BSdP  P`p \@  (~P `  B R9\pA@ 4 0 T  4` 0 0a, @Td  0`0X0 0Q`<0 @` QFH40<00D0 @`pdP R*#0d S`0 R 0ch ` B` `P@0@ ! P`  1 x d\o$qp$`@ SeP@Pr`0`# 0S `` 0l00`X0L`~@<00D0 0d0 } d0P 0C 0L뼢`0 0 $eP R6`$ $0d KdP`  0a\ 00b`0 `$l 0aK0@P0@Pmjg1Lp 0 pl0T@``10 <0S0ρ00 `@T ^ 000@P!< /@:TD  T00 .0`00L`_4 xx8wpdXX Hh\ 0fHpc P$0S@ 1 R "! !0###R0DDD0$K@Q9:: 0P<0S0S  Q #$0 0@0#$ Q0D0 0 P 0S0C  8#8 C("(00 $K@0( ڠ@0( 0{O 0 v p-L M1@SP saP8 0S,000>P8Kp vKp -MLM@<<Ÿ P K8LqŸU`(K P< Bw00 _ 1 R18K<0C0S<0&%@RXjj`? L<0 l60l 0` GpC UM8K80C00 0RJ(KV:`K,HH8   ~0S ! 0 " "Ƞ"S CCC X 0ႀ " 0X tpp#@0@0O00vh PxR -L M @ prPP 0H2`a 00 Z JV 000 0Npⴜ0Q(K -LM40@S00S040000 `1D00 0$pA1< 7p0C 0R40 0NP`p P| W 4NV0 ^ | |  0SPW00 `D s `  R 0S  ps"nR 05 $0P8V:D0PD 0P3U0V1D0E2PX%X.U* 0 ᫟P 00000P@L0 (K0@V$08 gP8 {1 c00 (K00PV$DP @00E S,`V ڈ1  U 0410CQ 4 0 B Qs" 00lRX3%Xu1PX%X`10 `DPD0P0CD0P0S%ʆu P1PD  U XD %X`V `DH  A PuD 0$10C0S081 ,1 ;ce00qNNLL -LM@ p`WLWJP0P PASP[*0 P6 @0^ S^ ^SP0)P@P 0S 0  00Sb 0 ~P 00080080(Ko@(KP00 00S Q0008(8/40P(K4` `D0 0P 0 @ @ <0 8080 80C 8440 0 < 0@`p D0 0C 00@400  - @`501@0JJ@0D$ 3R @N !A$0@DRLP@ T00t2@@`RDAKhj -LlM0 ƟX@ p` 0Pp0 (p 0  P| h p0 000` 00@PE0SE0T Kl \ Kx` hp d0 t `p 관Up PX%X G 00E0d0Ppd00d0 `P ڴ R5h G\ X 奘`0PHXP%X 00CT l tx P0 )hpx @  0x0A00@p 000| 000(Kp0hp@|0`x 儐 0@0p|)l@ t 0 Y*  BRp≐PU R(h#"(PPUD0Kd0 L0K h0 % RH @  RD!Pi `d h    0)Y* \ P B@@ H L D `0Sl0 RH @  R P3 0d hl0    d hd h`0t0<0K0 0 0 0bP8Z <0Xl0 40`St0 P t0@0 sK0 @ B("(xN Y 0t 0ל0Pt0 @R 8 #8Rx0  00 t00 oG0S t0P 0 |0x0  Ax 0x 0 !(t0P x 0 20S M0x0 -L MP @hT@p 0\`@D00 'P q .pP* Z00 8#8R50 (K 0(!S $1 !0$1 0 R WP 0 P0S 0GP  00S$! 10$100 -LM@80 0PPEXY0 %X0pY 4p p U P!` `Fh&hඹ0  ("( F` `00LPI} YgP4pPP Rp R010!)f P` `Fh&h 40 傹 `E E 40 pG Aಐ0@`0@000PPEX%XW^ ` U1! )80PI )P PEX%XP pW ("(! P E @ P 0  000(K @  p PPEX%Xc8  W0P0E(K`0<P  @  PPEX%X -Lp` @P 0S00 0PU@ T X  R P0BQR R-0P0Ӄ0S 0Ų00@8#80 0\0 L0 X800C80TU@ ` -L M @0T @`p@DH$H^P%0S70   ٚpPJ( @00T@`0@DH$HTʴ0S P #0P` P(KP T0 P(KP(K 0-P@ L0P Q P P\0ዚ P0Q 0 0 -@L PR`  R 0 Q0h@P0R%  0S㲀Pp> 0pGS \B P 0KP   0(!0S$! 1 $!0Q 04P @p0弐ᲀ0p 0 S 0! P ἐpGxP'x 0$! 1 $!(_ 0 -LMP @ T@p0 0CS 0@D` 00 "P nmP( 0 0 0YP00 8#8R0  l(K 0 R P 0 0 0P00 0-LM@ Pp10K0 -LM`80 p 40KP @pI k8KP50Y0   $``↠ ⺠ < K .\  `ഠ 80Lp0`000S0Y(K 08 EP 0C8#8 p000 P p -L4MpD"DŸ Pw ^@HP 0 _" R 3:* LPv XP`b XA1 C\[: @ Ƞ,Ƞ V%: 0C8#Ƞ ` !#⊶" 2 0" 2 H00 0 RD(K HR  00C L i12 S ?p rD Kp D 8 8 K4 < @ @pK`h&h`0 ၦP202Hn P -LM@pPQ` >00 2   Q v:1Q0" Bz!24 00 00 40 V^ X[ZFWVHT0PUO Q * 2 13/pW 0S* ",, ( A,K0  PF0S: 2 K04 KE0PVP V$P 0  0 K0PUP`0PU Q:0(0$PZ 0  KjP,   ( 00 KkP 21 l,l -L$Mq`@TP  llSdAPD|00CS0=$@4a Pp: @Y@DOoB0S@ K0: S F]P 0S 4K-A pW + [0 R@@w A03 KlTR0 @00CS0܊0 (f1(&x&t1~ 1 -LA --LM  ll/ K 0-@LpZH:Z4Zp0[zp0BBB -@LM M.K@; B &pP! @rI I '-K B[p i9Vp`9W:j9S'-K B[Pm Z(K0 9Y  i@P I P0FBK0l! 0 @OX-K P1BK  @tiP kB.K, BFPp`BK @iP kB.K B20Sa009BK0 0 @O0X-0K 0BK  @GiP kB.Kx BP@>K 0C0C(T:BK @|iP {kB.K B,@` p|d"edA_Ԯ-Cc 0-LM@K0$`0 pP  gpP0 PP Khj4>(@P +>Kr~ Q  -Lc M(& -LM K+ @5 K+d @>K K+ A @* K+< @3 K @ipP K K A @o K -LEWM $ $0$ -0L< 밦 $ $0$ -0L( Zܭ4 -pL`W@P  <0":k0cS@:UV 05@P8 80 $0Q/ $0S/Xr L#<<0 0R/$ 0S/r 8 d" -LM@Tp 0S_/PPX`@Q0@ @@OPP 0(Ko/(& -LM`P{jqA  Ep1A0Q,4SQ 0"K#K04 K  0 ^XpEllP3 bP) BP 4jh d>OKeP0 fP 0tP! nP0 sP0uP vP00 06(0000 00,40000F0S 0S 0S0S0S0S _<ɆP``&D&T(&0& -@LM`pPb{li@ @ X3T#Bp* fPD LP8 P8 HPA `RP6 XP PP ` puP#rPhP/ oP0!C!-\\ R0C020PU UT R7 Y h㥓w0@S` pD2@00 00  `pWPPVPaPTqp {P   fPb 0P0#0 T!YaPP`KXp@ lj% B R$@@@@@@0S  X  X 3{ 6/P00S $5$ Pli !P$ Pci tPY pP0S @K^&D&0Cn,]<}w -LyM@`ozi)0Y刉则y0000x)yCpd9p@DTT)0 RS S@ 0S0S0S ͒aP03 NP) HP LP ObPP$ RP0lP* fP(! iP00rP vP pP000000000X(0000000000 (((SC 0S001 0S1006V7V7@DV1'2 71 V P"P1P/X  1!0`001˻0S}K<W01 0S101 0 C C10S S/R }KWp)0Sw &WK~WT1: S0S 0S 02 2/XS\&\002 @IPU   0P2 c v0g 2 P0@ /Q50CSԏԏԏ$ Ph  xP2SI 1 "`0000 S\ <L0, S " 2S /P@ P2  0C2 0/S 0V/S/00`4"00B0 S !%!*"32P$002 840S S/R! 3K0S VpX* KQP! KQP gX00: S  C CV0: S 0: S |v : S  S  S ^P= P: Sx S1 L0S !E`0eS 20S V  vV3Ÿ00Ÿ S2"Q \VP2!PQ  <fK@P0S; 0: S 00V\10S !00C0!S 1! ^PQ X0!U |0Sx ! *`v0Sq ! `ol>IT@0S 0S d00SX00Sx WKUpw!㣐1: S Tw  ( ( ( ( (D& ( ( ( ( ( ( ( (_&  _&'}=Z|&&6*Ńw??J< -LM@PwdhfT&@pHD6Df@8F`$PP$6($08`a6 80 R 07 8`TP($ 6aE帅$P0(058`$0a0%+0@YaP30P L5L%8`SP( 80, 0$%$3/ 0(0 0(0SIa씟`QP+aP 0$aP 0000#0 ?c#0 c0; S 004 ! 08(1/8d0`0(T$.+"4`` ` \I8080 CS A3#0S`0 QP @@! 0SЀ 0  3!`Xp ` 0 >a(PU 8003/pg0S Y80(03/pQ圢 2 #K0 Ÿ `0 KQP Z  80 $0(3/ ?#K0#K! R0. $  !1a 0  80 (!1/0 $10  `p` `p`0)  ` 0 #KQP`t 0   0 #K! ! `pb R70 00003/n S_ S(`MGD& (% c&<0 ( ( ( ($$p ((" (D ( ( (D -LKM`p vdJ ?p  $0R| S 0S} +iP5 aP( GP0, PP: PdP L ZIFgP hP000mP" kP lP00nP tP0S S0 0001000 000;00600$0l9PU 0STnS0oSP0 00,㺵P P`P"P,ᨵP{ PS 0S8BK娆PQ 1SBKrb0PA 1 KN@ZH0(X$1 $1ZL(K0F0h`P  0: SbP  \P 1R p 0 'PP KSPaP/p bPX7 TA 1NS0P 1 @ g$1q@`0KS# 0 00G!G#xG|0 G%G$10$1 1 S`(0 `0S(0-0S,0 S  S$ 46R004$0S; ,0*^GK 06`pM?K 08 00M?K E?K @AKd`@@K?K O?K G@8,V!OK 8!(1##81 +V!KK (!1##(1 1c1s#p 0 DF0`S,1 p<  #!`0!!"#`0!!""`M?K 0 00M?K E?K@ AK!dF 0S #؃`R pf\ 0 0TFLFV,5 0SV/*,1  K?K0SV+*EK 0O?K0SV)*GK 0~ 0 O?K K?K lxF)KK (!V'#(1 V!OK 8!1##81 {!1!  0@AKc (U(&0+;D&-<MJh(Y (Va 0Jv| I  -L M, ( (0UEP(000%0PDr0C?o20, ((<p( !( ,00C,0 ,0S9 (000-S40$41, R(0pP EP SP QaT P[FCsP xP00x(4 $4  34! 3L! 3 (00(0 ,00C,0 Nh4P@´㿴㼴p@P7 xJuSTL381S p#p@FDcQ^efPdHs0S 4aVB() tPM81S% "2 Eぴa 2 ,0S (000S (0nP (0)ePԶPR(000!S (0 Lͻ,0S (000S 㸶Pt4E:T``0:D100P S t!0`00} 1 Mi@P n@P| 1 h@Pjt t t(081SZa`@0`ptqPQ081SqiP 0 pcE \^EP`UP3$081S| \ D0 TUiD (D&(&T0(Tte(ep< (j (fz(\Kp (Y&$(x&8(( -LM@P`/[P@PE@P3 DrDB :p?(2Q-= 0Pq EQ R[ R] R1 0!BSQY KdOPT0: SP00  !:pd10 ER!NpEhP LP" 0FP yPP fP000sP0 iP000 nP00vP wP 000000|yCB KN@P0: SpGP yy@((D&<1 } -LMP`q0_M B@p :p10Q1S `00 PE@TAmP pP SqqP lxUqp ^XB @ \0P x00 0 S0 NP0 0 80K0 NP 0.00 +` Q "0S /Y rMpSdNPD*`Y ]MpbD&0CD< -JML M@pgp^Rb z9p1 @DTۃiP0 vP fP 0 0 0㵴D Q1DK ANP4: S T BA0!CK⡹ P` 㬈C>KP 0Y/S / ,0K0$C`@T p6@p @/R0W/P #0 S :XuPp ᶥCK׃P(D&0 -LDMP@o4$ 峡dKMP%KdK&KLdKMP%KdK&KLdKMP%KdK&KLdKMP%KdK&KLd围@\3\#X3PK@@ @ @@ 83< KTKT0 前P,< KTKネP4< KTK}P8< KTKwP<< KTKqP@@< KTK T@ iP< KTKcPP9x2 K<P <KTPH"ո<0S <KEP<0S <K;P<0S <K1P<0S <K'PKQP!)p p@PhA \1R@=T`@ 0p/S Y(1Pp'`V   000/00z)00CSꜹ̎P0000S n80s00Ȑ8t((&&p(P0(d\(&1 g&&UOx('(P(\(2' -LP`nG]@p 7pt00S ]LP PP@@TᄛP$VP ?4D& -LMP`,Gp zn]P P 7p 6 pGW/0S (KfP RP" PP [WP dP`rP iP0`0vP xP`0`0 ` `$`P q ; `V 1S ឲUI䅟䕟PU KLP$0 S50 0S(00 7 @`P/Q / P` .QQ .QQR` p  Q 00@`X0SP$0 S0S@?P `pP LPPD0S <8K50C S_ꜿؿо0$S P Ph\ 00$ @^\ 00S $ ?RR00R0SX5S S4 S4JP8 0S 0S  ' $ 1\ 0SX  P  :a!SR0SX PI 0SKP 0S0St 0 0(oP j0S 0Sc 0?S_ 0S _1>렾0S 0?S 0SS [ x0: S R } :S0R0S0: SIP` 0S&a'00oo 0bS`V  K!P SI 0SJKP E0S A0?S =0S(1D&<21w1} -LP@l6[p` 5p 0 R1 P0C@P=pPp IP&PW` /!P 0S 0S0PIP&0.D&< p-LTMl h X@7K 80!P@ L@ H@ H;I` ;I d HP 3 Z/30X0 XP 30S S" S 3 *J 33 x3 0X0 X30S X R 4#6 R 8# SR3 3 3 #20S) DK) 2 20S -X0S00X0 0X0 26 Rf H@ITdH@xIT_0K|0P0KVdB00CS00  0 ( X0S X0S< l160SZ =  U1! I 11 ziDKhl`1n0S h00S 0-S0pX0 I`0S `Hd*HId0S0S 0 X0 1 0@T 00S @`P@ T0x0Ph00Sp00S 0 0 H0Sy 0X0 aato(Hh&8(((0(4(`((((HHi&i&(Hl(43$h& -LMs@P #kY2@ @0`S 2 ;Z"(4p 01 K0 IPt`K兯P\㌃a@P@ bYGP t@@4 KHPP%t KHPH%T) *00S@0Kt 4K`KL0Qah0 l0 0Ql0S ` KYPPh0S 4 K<HP,%;`KnKK2PKKPKKP0@0 00 @`K*`K*0l0 000  ߳P`KeP D&H&}``Bt @``0<ht@`t@`|&``gt`] -LOjFb; -LM `DjXX@0o0C?oS20@ @ @ p3p#0p3p00S" ST 0S5 ZX3 Y/ \㝂PP HP LP P03@fP RP & hP vP00 00 00 Y0T 00<0!S5 : P  @5 A0S #S @ 2   9pPN 0`#A. c0P0 p0p KvGp .0S0 00050C SA0xL0S [@P0S- $ `4X` 0 3/PP #$ `X p`Yh0T00S 8W:(i&haD&pa0n(]w}<  -MMLM`~iJ `i1 00 1i1001;iXX:L 00P 0 pP(Z P zNᘷPPQ {A@6P񟗺lllllpd\llllllllllllllllllT\llpllxlllll0USP( 1pQ Q 0(SSS "011 8 0010101LP0 8P$ C p0  4"R 0 p0 0 ع 4"R  p0 ȹ 4"R 0P 40p0y010000010000f0d0b ^ ^  ^ QS00 00011qW 2&o 9U1SPP60`FV!R UU0U0%;_oP%!1S KAEP4: S011PEU<|8V0 1"V *&,姬(5P0 50BK% @=:BK @ÆpPBK A"p)r@P cD$+t4 1-rD04 4 4 0M.KNK BA4 CPPP&7MK ACfDDbDwD<cP4D@B>KNK 0C$ @E4S P$tpPUZָ0#S MK AC!BK @E㡫NK@e0E?o2? MK ACtWBKX @:PPBK A!f/[]"pfrW %PPBK @D`s:00CS0 rP Pp PNUu0 P00CS0|r0 V ^%0 S:00S:0)!V1 1L%1S1S 7Pdp|!+D1 e,VD:P HQ!P-p0V,4 wB.K BH %P440`FVhP@fP  f/峰0 ŷT  &P D%p((qrKse0yrrs$sXs(rrrrr(i&D&(UjsOe <(x&wsera~sLs&mdCro( -PLM, 0P @P` @ q19Kp!0h`00CS`0X 6:@TKX0 X @r0(4x& -P`p@0L\MhP dP `P \P XP pP  t0 /pt0$`FVlTT!Yt rTdT x0 ^Bpx0!|$|x~lP aPP Q @R_0dP@pP nP p rP tP0p0 dT0 RT ST QT0X0  hK/h K Cp (KpTM rT! lTV p :0 hKh KX CpH'~ TK0T K Cp ( TK⽶ TKU  DKV@F0PpP  t0GPaU4@ 0p T K bCpx@vPl `H R @? I ,9C" l0K P;U! l@Q 0 M !}l0P|0 }VP'p0@S8|8BRlZt0,pK1('S x 0|@Y S p/x(RPU 0P 0P @P 5 4 Z} 0 tň0D&шrE~D݈D{D|D(!0?K}D\jwD<yaratcidԉ 0-4OLeM22222222220P1 1 1 嶯. -p2>`PpE W}P 2S 2S02S-2S*2S'2S$2"S RX R2(_ "R S4 0s|$ bP 6EPo "2Pf 0P>] 1P^ 03P` AP-_?Km 0 B\P |10S"|2RSP_ FP0Y IP2TP6 aP02sPd iP" cP fP02lPD rP= <02tvPH tP  uP02jwP zP<{d= P  ʌ  Y 4= (= `H| Kb<=10SPA ]|2;028@[k0 6;@T(K202%02;/`գpP000pS K/p~ 01 W /£`P000`S K/pk 01 V /ᯣP000S K/pY 01 02_?K0:j0* 0合P |10S {2 S;2R28j/p~P WK.APT1: S :  `P ~P/hP *0  !P{LQ?P X?=4K$Ap eK*0R0d  VT P9*1 |?P1  !14)S o`o`?b02a8{p\p802V0 SQ 0SW10 bV00 0`0 `>K KOp `MpP ``>K KBpp2S WK@PT1: S022S 2S2SQ` 2`S2S|w0 t7jP p0SP L ` >p ,WP/ M{P4 f/囬 7,0$7('4v?S㠒"2"2 W.6PT 00P U_MP Z pz2 S2 KG@pH >0 0%K(   %KcK 1/Ÿ0 cKЀ4 4.2,72(7< 72$7|u @p | @ppVdH%u>p`x > `p$.P (2%.`Vp%.rW 222222T|2S"2Q|"t !14!8!K0>K]/K^K,P`F`1p!0C`1 0K0Z/KY?K[K ,P5d1`Lt1h1 , R0cK xl1 *Pe?K1!01!0Q e?KcK P0P u !p`_ YV02S\(D&$1c(0{.Jx(t(S^e |(<)UМ(ĝ1)8(H(םrdA edA'r^>Y4(")ڞ 0k&Ɵ"V( iנBix&j(u())<|04 ᗮᕮZᨠ>K0]/K>K^K+P x1 St!#!p!!#`!SpW X+1"Rb~*> R0;|2 PR"2R SP1 p10Sxo2SN2SK'01+8FS 2S/2S,0/P' `p`" 0 h-,0!`" 00^-? 0! 0 " 0\R-/X. P 2|bSBpl 0! ! !42S5 2S22@t+@2S.P% 2`p0 0?`(-@0.P 1T011P#011011012׃<ѣ<2BT /2S202S 2Sr2S 78S8S .P 11 /e$$P <2v7x5P 30aS0 XSq (abS"+ cS 0 )a2PՊpSF mS) nS9 fS00yxSD qSx"6ySA zSd"000i 0L `D2<T/^000Z0L 0V!0 `2 >0S th!000\1 <`!00 D1 4!P10H0 .!0001@&@K0!0 0 c ĞP3S KuS0 `lS sS" hS `|wS* &zSp3`3X᠀qxpnpBk00h0 0e43`Ha 3 ] `,3XY p CX0C(0 0R2`O5>KPe!00 0 Ȃ wP3S r"lS LS aSt. d"CS*sS mS%wS zSHL#Kp0 L3S  0C,K!P @P!J@)ẹp``p!< $Px!6 P`! 0S1@!|坣3/ Kl/KXP HP<1)p&; p&;p&;p&C)C)C)D&C)278p&0o&;Pp& <C)hp&<(<--D<X<5t<4 6i<Z:<gui < m-LeP Vq- KhF)7C) 0-L@LHP@,('K0h,C)u&DQ0Q 0-L@LHP@,( K0hC)(v&\<[ -LdM5PJjP56P0 Bp) P5\5@P L$6H2@P0<"@ 4244 H6 DKSp DQ  6P  @ p1a 0i0 @ p_0 @Y xU0T0 P0 L0 H0 0 0000P0 0 00TK$@P } TKd4 DK@@ <@ 8@ 4@ 0@ DP u DKu{4y4w4 0 X0 ,0K4 #@@d K\K\P apcPPUPh0PP 0/(KD0DUCDDDDRLDD_v&^^^^D) -P`|6LMtvtF P 0   pL6Y q o8 0 0 00 0K 0K00S 0VS 0X 0S0000 10S91 0S! 0 P0! 0 Q 0s  10000 U`p V@[3Y  3P'ܧ 0A?oR20S K*4PY)KSR 00 0 #  R S 3P0sq  3p3Y 2 0G3dF0D&D)<FPFCcFzFFFFG|&G)G -@`'ML M⨆vV I I    p6p9PCU19 U$ UYT' K @ gPP^-K B00^-K B0]-K4 B^n0 p@G>]-K0 B 10>n0S0ST> rL. R   t [ KӤZK B0 DLP^=K 0C0r04pP kP0#]=Kn`(0C`0#00@00S:K,0C('R 4SS *0h# `CP  l2Z$ `9P Z82$0S0,P 33"ZPV=K,0C `p`:K,0C4SS V=K,0C 2 QP*hpp]=K40C0 2b ?,!0I[p X  h^=K0C04 KAepؘ  <]-K0P4 B0  1$" 0b#p|00S 0# ^K?A V0t]=K40CO=@` 0R$| S\ dF)f\F)_ff0(F)D&w&%hRhf|F)r(&fF)hF)klfn" m0mGmmmE|&gm.g)nLnKg`F)K0CKK(A\P KZ AK'PKPP ]K A᳍p h T:K,0C4  h=.K0 BDkH -<:*ML M p`Z* * *  p@ 9P0pGs00W ZT[ 2NT[ FT IT DT*K A )8#80* Rl0CQ (X"(fST0B VTQ OT0 0 0 9mTd fT0H iTR bT0*0 0+8sT[ vTf nT0!00 0 x8<0:  d8 0s000(0 <0,,80@w 0 0  0i0*0 0+7]0!0 0 7Q0c 00 0 07D*=K0 1 T1 tD770'40S1$?f,0: )) K  @K @Ya稆X 6 R, 0S6 R0&*p  M )K A+p lF 0*S@:K0C 0 R0$9[S >K 0C QP*`e0U; T0P: %Xe)K A6+p 0S )@P * K@Y^0P:    Z 剖PPZ z:0S: Z>K0C0>K 0C Dp 4$Z K`tlPr0`4ᓛP ᎛P#80we^PZ #0St:S0( $9[S K @*0p# :SjP3D#8cH>K 0C _pp  $3!0#Wp d  Ee:4 KAÁp8( :: z80P: *\ 20呃KA !0 Sڤ:0>K0C z*?>K0C R0: 9Ѐ!4PQS4   : |X0::+$$S$QQ 10S8  0 B  (:SppW (U>K0CP 0 *(pld>K0C K R?A : 8X0:*!  *X0:1 : X0:#100N*Ox0D&|&wk0mJ)KgN*N*lN*fn"E)nO*LnTiN*-xwhh@ieihhh"vh i$ixwiiii:j -P`LM  P `K)OP Ud )PZ(p0((p 0KP.pYn 0z8 pPp W l>l.l> W (PX <>FP x(P4<;Sq(P`h $  Ih 06O =AON0 ( 000PP =0 ٰXm"R1<;020YCl=0S C@4P\LXIHHHHKHH8KHHHJJ,KH|KHHHHHHHHHHHHHHIdIHtIKIIHHJHPJ\JhJJJJDKH KL 09 0bhl KY0P 00R0S 0cN 0;8;08;G 00;0C@;Kq`p; K`0k0S 0kEP +; K~EP$ +KSc`k K00S0?S H<  0< 0: 0 7c@0 0:0@; 0@0 00 008;0j K0P0S0?S :Pڀ 00t 00q 09n,j K00PS (ri K00S0@S cK 0; 000) 0 0 000) \iKЛ9C00S 0DP d:Y <@y0 0t#td5x!'x!8C8S.̄ 0 0G 8(#8"(4 0 5q  KTrKho 0+K;    0;4< 5 0Ux5ԋK0$#$0(00"(0 P5 Z4 1pЖ H]P( X0 0RpUx4ԋK0$#$0(00"(0 VT'0 G0D lpw0X P00SU 00CS^_`8b8b```aTaxaaaaab0 sP Q>$_P_X_`_h____________w  0P+K`0#!a   0 (PL $ 0  PD Q@`\`d`l`` 0p t x |  #0 P& 0$!$#("(! 0 P  0 P  0 P Q Q 8 < v@ t0 P\  0 Px  0 P  0 P  0 P  0 P  0 P  0 P (  ; `` . 0P+K0S~ :S4 S~0p0CW0 "U WB 0C0  0pG 0 o00 S 0'0C1  00C0 00 0 00p WpG BY U3 t<;Y [PU HWB0< ḛ> jUw 6P0H00 0 CI!Y  0pG'q0C7!  <   AUX Ux$30P$#+K 0(00"(0 " 00 t -LM`Pc2@0P-S@ᑒP/ @04 p$0p  p*40SP a`F PZO.PģQM 0CK!PM 2 O\\P@ `3tC d@PfffffffffffffgfffffffffL@ RK@HGG000 p 4 宐4  W & ` \00S'T`P` "P`0b 2 R @2 \20 S 42 /2U+ 0 H2!20!002X=:741 .p4 ,p0StXdo` p0S{냔Pr pp@@1 0y[ VplH`Ta+VD&~ <MG3_l~oGÊ6ي -AML MP@P/帇P㰇8 岇P7'` 0-S& l-P ԏf-P9[ p @ `FPX@ /PE0S0 P @DDA@D얟f{b@Q 61 Q< 埏1-P -<ZP@X-   p pD0B5S񟗕4m j j j j j j j jmm j j jm j j j j j j j j j j j j j j jlllm jxm jmm j j jm j j j jmmm@nLn jmXnp\ CKpqH5040S 0ZP Z00 $ p d0SMt4P Z000 04084 4 0S |kZ `4 00,tL_P 4t CK 4040S P3 000 0t0C?o#2p R0S 3 P㤃㡃P㜃l  r`3@DX8YTH3Q00PE@rS# RSm iS tSr xSi r袟@T*O 0S ;W VP 2B R00/S |H0S T\ 0P@v4 0S 0S  2 00S j0S @ 0| Qlp PXa@T:BK ABK @ 0 BK` @BK ABK @ 0r QP0$00S BK @:BK 0 @ua> U ,O(a+0$,=U ,wX&ˍܜ,D&xE(&0,kd&(G,J&Jew1 Î@YlF -PLLMPp@O& fP SP@ LP ? TP; dP> sP2 nP* qP>tP. vP> 00. p>x>PE>A R tp>h>0S\XT> L>H>D> >"aV=0SP tP P=0S 0X0 ,H h ,`D +@ d +< +` 8 +oo4 +h bRd0S`0ZSYP Q0 +1`0 <`00gS <kC 0C00A0@! 00 0P 0C #10C0 0 0C0 B #P 0 0 0C0 B #P0 0 0C0 B #0 0 pğQP~ 'KPP͌0/@Sd0 VJZ4W00 pp'os`F0+4P# U0#03R0SU 5%PP t . \) KP0`0,#,R004# F@C PKopPEX!EV0P2"E0<6S"46S" 02Q" T201)|嫸6S l妸tP0 BV V 0 㕇0 P0 ~,6S m/PP }(~u<6S46S@d1Q|0 @6D&S1x0Kx0 t0KRp!  H&0R\!\ $&0RL! 8&0R$KDAP# <p P ,sQ$!@P`0@ `PD00S X Kp%U  UX KdPEUp R  Sq 0h mUkG@&D&-<-0----,-- -U4- M0D-@-<-8-& -LM`&!PPF! VF  pSPU `6pY P L60S aP& tP8 6 R $&    yp5U0UI Y"@T P P$PY  R a`F T$PYF  PP  H@ A@9P񟗽ꌕ̕ ,4HP\hܖ0S00a0Sz00Su00Sp00Sk00Sf 000E00B00?00SV@000030000 0H30 )0SB<0S=00S834P0$00S,<:(U 0S# 0S 0SY UU P p P l PU< UG U3$0S ]-Ug U) u#U  U. @U0000 0 $P U$  UQaPKPJ/ 0000  $Q *P LO# # ,Kp0K QP*k@ T , 0!$!60? $P @ህP ჅP` R{Ԯ-D&0Y(&vj0< -P@`pL pl0 R10C@Pr&RP fP'80 `&PPPbD&- -LGM  NT-%4HM60<-<08-8 4-40{{P$=0@=@=-@ =@=[@<|@<@00,00,0,,0,0,, P,0,P,0,P,0,0,0,0,0,<{`P  P:?% 0hNg\<X ({T<PP,L !{@P <$PR ; ;$@ᶄPe ; ; {;P 0S; + `K0S ;0PU P zP@ 各OoB;p _zp;p+l;0p UzP P:TP[P:P0$4 `pKq}$P`: v$P T:  n$P0*0*0 6KP 9 4PEDUꨟ $<,̠ܠT,44 9  wpP0@  Z$9$V B$ 414 9@9@88P =K0C  s`8-K0 B@4 8< D ۢ0P S#0 墚0'0'0h8 \(000P(00D8H7 @7@7+<y~ P:?@# 0f7匃P|7' 6 6 6 K47Pڀ40Sx ,7 ^M K#d7Pڀ40Sg 6D X6`_,7G>K0CPC /~\T fPG>K0C0C| 4 ͆P 0S\6"VE>K 0CPUEK A4p |!/0 4 P5 `fp&08%0H%e0b46P (ա$6JK0&F00by0P 0S =fEPS@P5D0SQ +}UP5?@# ə L4 `50S`fH5 eP D} <o4'y0e (W yCe Oyd Hyd A y ;y$5x$/x )D/!bsYxDoYlYiYXfY4Sڐ4S+  /E@t20SC@Pr S0S P 0S eed3e+FoPmw7Y v4:sP 4cPD@PH1DY< YV1@PY Y4@`8sPP0@P`!BNK@D+|4lD 0Ad4 0hd `4 U0FK Ap00fp2U p0B?o20S q R  1 4S ;e20S 10S 00w0-.\*.D-4--,---<-<-4-.-....".".X*.".".(-x.!.,".-".h*.U.O ".& Xx&(".4".&08 pOD&- ".d*..*.]..-8-}\Q(&p .$--A0".. -0-(D,#L6BYHRRd $. -  .! ! .-] -LM@P2x5[p5h5`5!XOP H5 vn850S ,E % P3KTq wPM `t脟 0PN9PFvPJ$000 p40`DVAT 4 000PP dS,X{0@D R&@48$  444$00K0@K$[tXt UtRtoPJ 00@&3`ῗ0p ')wP3# >v;s3 @R xSrP  `J f P P0Sf0CrP `  PdSvp@|b 0<0 00>00r00010q<|:x8tsh2h"Q\eT2pf Pc B18C8S "vgPq堁6q1Kl U0B?o20S! rP1K 1 [\q=PS  0 010010K 1KTr18C8S 1[F 00R0S P=?o20 P P 1K7r18C8S 1[ 0 PcPS 0Pp1KGs06.7.5.<7.5.6.6.:'5.D&|&F7.87.L6.mr />&s7.@& @7.L&z 7.6.6.86.5.H7.I <5.t&K. -^ML M`PP 6 vF 9px60S`V=X6P4 zD6/DP 4P 6 VP 10@S%i dP0 lP cP 050@00%RB.K Bx`0-S0S P y0SB.K Bx@_KAP% ?o 2R0S 90S}4p ePv z4 z@vv5: Sx  Sl0S  pP Havw  X UK AtP  NvT5BnK: S4 `F +6 y}3 P @ 6 ~P6 ?^>K 0C C P pX T 0S0S84v0 00y 0S0S- P  y0S `&0x  1vK 0C y 0SBK- @ p`BK Atu:`-K BPw 0S p``u8. D&j(& t&~s  -  > +   L a w     x& 0-鸃c00L@@P0叒P 0S00}P t3 shszZ^믠뵉냯,``|0V* s/R}P0c0&#3P_P xa䂟T 0+0C0SP P  }P@D D0S 8P X2 T3PbP 0S 8*P 0S20 2P R! 1`V `PET 0SPaPĖPݛ㜛`@DꇕP|T10S H10S0Q,%ڨ/ y1 @R1-}PPwQ PlP@0QP  {똋hꐛP P ?v.(v.<8.v.h..N<_ v.<,v.wsnr<v.< v.<9.w.<`h.@&\Q<v.v. -`LLBpDE.@R@` Xp"2 0 QQ @PPPEaJbfPL IP> EP8 0 ,aP8 ePx16{KhZ nP5 iP+ lP0 ,,SP$ prP uP0 SP 000 S00000`0t S000 0 Pid0@9P HLF p.`00.D&'`(&&_`4.<.$. -L$M%rP,Fğ L@l4/3\4P@ 0L00H0 +P ,4 $0HA@Tn`PtD@ @@ <@ 8@ # pz30IYZs0崓0 1 4 K0L #[3[R S 0 H080S , DP "PD0S  <0S    @0S  r@P 9z@{"P20"  -R R -R i^eR^|iRy kRv eRseP8 QPN EPv IP) -P paP& dP$ SPh nPe kP) mP2 iP0`^VZ0SW ?S``SrP) sP* pPp080 G\C0P^U?0S< ?SPP80@^T40S1 ?S@@-0<0 '0D0 $0@0 !SC0S@  R;ڴ3K04 K3Kz 3h0lngYꐓ.c`.0|&.&0?cD&0..ht@Vc(&lcrcwcUnxbcbc.c5c&cgt -@`PLTMrp@ `p1p`FVU  PlKGpl DgP uP GP0p0 0P0S%@0Tx@  Nx p`V g p!D?l K  `pK"~ P R YDp V lK p T xp U p|mDPU z_ TpPL@@H 0C c0D&c<c1 d%dUL,d 0-@b"02L@2P@2b 2p@_2b/|B儂0S0t"5l"lB50d0pP PP pN,:P3 -P P @ tfP CP DP pP rP 1 71 CiPt1pQ:`p9`0@ GSfH1Pp8 yP- yj .m+m(mEStj000!00Q X[W+ 0 np.r.....@dF....& T0(&3..-t.0.]? |E ? .... -LqM*@L%`p<5<@ A ! 1 (% pPI5 HXKWr *P 0 qKP1: So?K& ooTb`VKoKk WW  |sK{t.@Ppd  0P1  Kv1 }v1.P4 CfU% bU eU b{pU zU! lU 1 0 1`!0  0~ 101 p0!0@~yP,^@P D ,,(T 0r  2Q 2X 0"q 00 sX%XpP 2  0P1  sKiPx]PPl X A ] !4B(IF,x(v0!BP gl k{!EP![{0S pZ᠑0< K(1Q   S  R#4z # U&qP 1 P 0{0S z 1 ` 0Y {0S T z kWЁ@pI/I/0X D&<c n  M   xI/I/&ht@I/I/ )     ȸ -LiM?P0 00 0`1 1 @wP wP ;7>0 0 RV cOKV/rz> K`1 00 0 0 0 h0 ѣ01 1 H>H^1 0p<1 #0>K0  >p,T뼮1!P1 0cOK B141 08!  La MPP#0u `.1 0CS> L>|-00+#OVPX NPJ 6P3 ?PR 4PpTPD HPP#16;3kP( gP) jP fP<0`1 pP ʴ 91 S 0(!#cK# *#c?K#041Y tP@W8 )W|800p8 (+-cK# 00 ဥ@y @$MY@8 Bpl KPpP oK# 00cKh ᷏p  1 R 1 AiK⷏  P h P0  00hP%Pp 1Q +  p  !@PW ![Rp Lt,0Ka!P6RppOoL!P b<&B R` ~p``W@Tf p1!RS 8Q1 o?K0o?K 0(0460| 0s| 0s 偌 |`:}Vx^lGSx0S T双1SD pW1SS =x0S. 册W 5x0S( r~ IP1SS =d`gK$! p `VhZZW UZT#0(44Tpw0S $45Gpw0S #(P  q  ))4!11 rP1 R4! pC Q0D 1Z@i/K ቍ#0@p 1`V@Ѓ0%00(0 180M 0W CPpfL pdH 0T(Pɝ 1BPUBK⃊P|h\s 0S   j Pl 0S ~080 C0p D0sp` R080SW 0R  @㭈 0S 0 0㤈P R 庋 `V a 2 vvW q(/( ( '  p, , , @( ?(  , 0& & & & */ */6 */*///*/@-@ss@*/ps_strings missing 05xTȕN;= ;L>DpGK#SPKRQPCxU[laֈgmT xx ,@0p$$$$$ %P%%%:GMEG eT eii߀r ̲p: dddTR XE. DramdiskbinUsage: %s ..., where is one of: %s: %s not compiled in chmodlnmkdirmvpaxrmdir-shchownchgrpdkctlfdiskfsck_msdosifconfigmknodmount_cd9660mount_ext2fsmount_kernfsmount_msdosmount_tmpfsnewfsmount_mfsrrestoreslattachswapctlcugzcatgunzipmoretsetchrootprogress%6d %6s malloc, using %zu buffer%s: not a regular fileUsage: %s [-beflnstuv] [-B bsize] [-] [file ...] B:beflnstuvUsage: %s [-R [-H | -L | -P]] [-fh] mode file ... %s [-R [-H | -L | -P]] [-fh] --reference=rfile file ... HLPRXfghorstuwxthe -R and -h options may not be specified together.Cannot set file mode `%s'Cannot stat `%s'fts_openfts_readpushdnepopdneHLNPRfailprvthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s is not a directory%s: directory causes a cycle%s/%s: name too long (not copied)%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).dnesp < MAXPATHLEN/usr/src/bin/cp/cp.cdnesp >= 0directory %s encountered when not expected.%s => %s %llu/%llu bytes %d%% written lutimens: %schown: %schmod: %schflags: %soverwrite %s? %s: error copying extended attributesreadlink: %sunlink: %ssymlink: %smkfifo: %smknod: %susage: %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src target %s [-R [-H | -L | -P]] [-f | -i] [-alNpv] src1 ... srcN directory ]@@0@@$@@P  @@h+@@unblock and -DNO_CONV?`<<00oflag option disabledmsgfmt option disablediflag option disabledconv option disabledprogress blocksseek blocksskip blocksconversion record sizefile countblock countoutput block sizeinput block sizeunable to allocate space for the argument %sunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs meaningless if not doing record operationsconvibsiflagiseekmsgfmtoflagoseekskipdupfd IO%s: seek error creating sparse file%s: end of device%s: short write on character device%s: short write on tape deviceusage: dd [operand ...]files is not supported for non-tape devicescase conv and -DNO_CONVfsync stdoutcloseposix%llu+%llu records in %llu+%llu records out %llu odd length swab %s %llu truncated %s %llu sparse output %s %llu bytes transferred in %lu.%03d secs (%llu bytes/sec) skip reached end of input100 0prtstat%s %6sCan't get mount information1024-blocks1K-blocksonly one -t option may be specified.empty type listcan't allocate type arrayUsage: %s [-agln] [-Ghkm|-ihkm|-Pk] [-t type] [file | file_system ...] aGghiklmnPt:only one of -G and -P or -i may be specifiedonly one of -P and -i may be specifiedretrieving information on mounted file systemscan't allocate statvfs arrayWarning: %s is not a local %sWarning: %s mounted as a %s %s%10s (%-12s): %7ld block size %12ld frag size %10lld total blocks %10lld free blocks %10lld available %10lld total files %10lld free files %12lx filesys id %10s fstype %#15lx flag %17ld filename length %10lu owner %17lld syncwrites %12lld asyncwrites 1M-blocks1G-blocksnon-standard block size incompatible with -PFilesystem %s Used Available Capacity Mounted on Filesystem%-*.*s %s Used Avail %%Cap iUsed iAvail %%iCap Mounted onhflag == 0/usr/src/bin/df/df.cblocksize > 0%s %lld %lld %lld %s%% %s %-*.*s %10lld %10lld %10lld %3s%% %8jd %8jd %4s%%Usage: %s [-] [-ESsx] [-p string] [name] cannot seek temp filecannot read temp fileline too longcannot write temp file/tmp/TMPDIR%sed.XXXXXX%s/ed.XXXXXXcould not allocate memoryw+cannot open temp filecannot close temp fileunexpected end-of-file& no previous commandinvalid pattern delimitercannot read input filenewline inserted newline appended cannot open input filecannot close input file%lu cannot write filecannot open output filecannot close output filestdin: %s cannot read stdin%ld  \abfnrtv\no matchinvalid mark characternumber out of rangeed.hupHOMEshell access restrictedno current filenameinvalid filenamefilename too longinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableunknown commandcrypt unavailable ? p:sxESinterruptwarning: file modifiedscript, line %d: %s trailing backslash (\)no previous patterninfinite substitution loopnothing to undousage: %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file [target_file] %s [-L | -P | -s [-F]] [-f | -iw] [-hnv] source_file ... target_dir link source_file target_file warning: %s inaccessiblewarning: %s%s and %s are the same directory entryreplace %s? not replaced %s %c> %s FLPfhinsvw %s: usage: %s [-1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXx] [file ...] 1AaBbCcdFfghikLlMmnOoPpqRrSsTtuWwXxCOLUMNS ls: %s: %s -> total %'llu total %llu humanize_numbertotal %s ????????????????????????%'*llu %*llu %s %*lu %-*s %*lld, %*lld out of memory!usage: %s [-p] [-m mode] dirname ... m:pusage: %s [-fiv] source target %s [-fiv] source ... directory -PRpv-PRp/bin/cp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status-rf/bin/rmrename %soverride %s%s%s/%s for %s? can't remove %s%s: remove%s: set times%s: set owner/group%s: set mode%s: set flags (was: 0%07o)ifv%s: destination pathname too longabcdfiklnoprstuvwxABDEGHLMPTUVXYZ././@LongLink-c-dccould not pipecould not forkcould not execUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %ld pad blocksFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed stat on %sCannot write an archive on top of a directory %sUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to backspace tape %ld blocks.%llu bytes%lu secs (%llu %s/sec)unknown format, %s skipped in %s Working on `%s' (%s) %lu files in %s %s vol %d, %lu files, %s read, %s written in %s %s: Waiting for tape drive close to complete...done. cpio%llu blocks Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Unexpected EOF on archive fileReady for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again Cannot identify format. Searching...Sorry, unable to determine archive format.Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot resolve `%s'Attempt to write file `%s' that resolves into `%s/%s' outside current working directory `%s' ignoredUnable to open %s to readCannot get working directoryCannot chdir to `.'Cannot chdir to `%s'Listing incomplete.Can't fchroot to "."Cannot mix current archive format %s with %s%s: Reading archive to position at the end...directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sWrite block size of %d too large, maximum is: %dWrite block size of %d is not a %d byte multipleWrite block size %d too large, maximum is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to copy %s, file would overwrite itselfCannot remove directory %sCannot unlink %sCannot obtain file stats %sAccess/modification time set failed on: %sCannot set file uid/gid of %sCannot set permissions on %sArchive was created with a broken tar; file `%s' is a directory, but marked as plain.Cannot malloc %d bytes%s.XXXXXXCannot create %sCannot link file %s to itselfCannot remove %sCannot link to %s from %sA hard link to the directory %s is not allowedCannot close file descriptor on %sCannot rename %s to %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCannot access %s (stat)File seek on %sOut of memoryFailed write to file %sFailed seek on file %sFile changed size %sFile %s was modified during readFile rewind failed on: %sUnable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s%b %e %Y%b %e %H:%M%s%2lu %-*s %-*s %4lu,%4lu %9llu == %s %s%s %s Removing leading / from absolute path names in the archive%s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar [-]{crtux}[-befhjklmopqvwzHJOPSXZ014578] [archive] [blocksize] [-C directory] [-T file] [-s replstr] [file ...] usage: pax [-0cdjnvzVO] [-E limit] [-f archive] [-N dbdir] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdijknuvzADOVYZ] [-E limit] [-f archive] [-N dbdir] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -w [-dijtuvzAHLMOPVX] [-b blocksize] [[-a] [-f archive]] [-x format] [-B bytes] [-N dbdir] [-o options] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-dijklntuvzADHLMOPVXYZ] [-N dbdir] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date][/[c][m]]] ... [file ...] directory Cannot create directory `%s'Invalid block size %sbzip2write_opt=nodir+b:cef:hjklmopqrs:tuvwxzBC:HI:JOPST:X:Z014578The -O/-o options are only valid when writing or extracting an archive-IUnable to open file '%s' for read-C-C Problem with file '%s'/dev/nrst0Invalid -p string: %cUnknown -x format: %spax: Known -x formats are:Invalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveSupport for -%c is not compiled in0ab:cdf:ijklno:p:rs:tuvwx:zAB:DE:G:HLMN:OPT:U:VXYZ%s: Invalid combination of options:Destination directory was not supplied These format options are not supported for %s %s = %s block-sizebunzip2dereferencekeep-old-filesone-file-systemmodification-timeold-archiveportabilitysame-permissionspreserve-permissionsfast-readappendverboseconfirmationextractread-full-blocksto-stdoutabsolute-pathssparsefiles-fromexclude-fromuncompressstrictatime-preserveunlinkuse-compress-programforce-localinsecureexcludeno-recursiontimestampgnuustarFile name %s/%s, too long ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Empty replacement stringUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sInvalid replacement string %sEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:Pattern select out of memoryPattern list inconsistent/../Ignoring file containing `..' (%s)CPU time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal handlerCan't open current working directory.Cannot allocate memory for temp file name.cannot gzip while appendingUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]Device map table out of memoryCannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sCannot allocate memory for interactive rename tableCannot allocate memory for device mapping tableUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryCannot canonicalize %sUnable to store mode and times for directory: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryNo interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory/^%s$///.*\/%s$///.*\/%s\/.*///^%s\/.*//Ustar %s header field is too small for %sBusted tar archive: has both ustar and old tar recordswrite_optUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sustar Trying to read GNU tar archive with GNU extensions and end-of-volume checks offHeader checksum %o does not match %oFileGlobalGNU Long %s found in posix ustar archive.%s extended headers posix ustar archive. Extracting as plain files. Following files might be in the wrong directory or have wrong attributes.Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sDIRTYPEDEVTYPEFIFOTYPELINKTYPEFile is too long for ustar %sGIDMTIMECHKSUMpathname too long: %scannot open %s: %spathname too long, line %d of %s/dev/ttyFatal error, cannot open %susage: %s [-LP] /./usage: %s [-f|-i] [-dPRrvWx] file ... remove '%s'? %s: -P was specified but file could not be overwrittenoverride %s%s%s:%s for '%s'? dfiPRrvWx"." and ".." may not be removedfts_open failed%s: is a directoryusage: %s [-p] directory ...  A A'A1A=AJA=AJA2`AtAAEAZAAAA#A A_B^BFB<B>#B?6BIBPATH= "J t%f/IdIIsL%cIImIIlII r- ϊpJEn JI vJ< b   EOF reading here (<<) document NNNNNNNNNNNMƸNNNO OOOO$O)O0O4O8O?OFONNN7HNND{GcHXUH}-+?=g"@QQ$Q*Q0Q6Q=QGQ@zHQ HHH HQQabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789/+-=_,.'l(0JS,(1RS(1XSX(8bS(0pS@(0S(0S(0S(0SS#<  !~<z % `. U  K-[ TEjTr ww!]>WQ Mz                  4Ԓ41 4U/ . {R G 9UP p@Ut"FU4kK $KU|WxعNUع^UdTUd; XUP@[Uh@kWn lcUkUnGXFc#HpU.S% wUU4< UU<dUԢU\U { ^$U ?Alias count botchalias %s=alias: %s not found arithmetic: unexpected '%c' (out of range) in numeric constant: %.*sarithmetic: unexpected '%c' (%#x) in expressionarithmetic expression: %s: "%s"variable not setvariable contains non-numeric valuetoken errordivision by zerodivide errorexpecting ':'expecting ')'incr/decr require var nameexpecting primaryexpecting end of expressiongetcwd() failed: %sOLDPWDHOME not setPWD not setbad substitutionCDPATHcan't cd to %sCannot determine current working directoryunexpected argumenterror %dinterruptedpermission deniedI/O errorfile existsno such filedirectory nonexistenttoo many open filesfile table overflowfile system fulldisk quota exceededno streams resourcesno such device or addressread-only file systemtext busynot enough memoryremote access failedsymbolic link loopfile name too longargument list too long%.4fPipe call failed: %sNode type = %d using redirections: do subshell () &) done subshell do { } failed } done Pipe call failedCannot vfork (%s)too many nested function callsinvalid count: %d%s: is a block device%dm%ss %dm%ss %dm%ss %dm%ss Command from PATH[%d]: special builtin function () { ; }internal error: %s cmdtype %d%builtinfunc%s not defined in %sbcfrsuv [-p] [-v|-V] a tracked alias forvVpusage: %s name...-v and -V cannot both be specifiedusage: %s%s name ... is a shell keyword is an alias (multiline)... for: is%s is a shell function is a shell builtin is a special shell builtin : not found :]%.*s: parameter not setnull or %.*s: parameter %snot setnot compiled with history supportsh: turning off NDELAY mode Can't open %sELFCannot execute ELF binary %sCannot rewind the file %sOut of file descriptorspopfilesupto() misusedsh: can't access tty; job control turned off Cannot set process group (%s) at %dCannot set tty process group (%s) at %dCannot continue job (%s)[%ld] %c %ld RunningDone(%d)Done (core dumped) | %sNo current jobNo previous jobNo such job: %s%s: ambiguousNo current jobsjob not created under job control[%ld] %sgjp-g -j and -p options cannot be combinedusage: jobid [-g|-p|-r] jobid%%%zu more than one -p unsupportednp:invalid name: -p '%s'%s readonlyYou have stopped jobs. ${LINENO${#LINENO${#${(((...)$(...)">|>>>&<&<> && || ! | if ; then ; else ; fiuntil ; do case ;& ;; esac() { ... }<<...Cannot fork (%s)you have mail: file changed Use "exit" to leave shell. POSIXLY_CORRECT.profile/etc/profileENVOut of spacestunalloc p:rarg countu=%s,g=%s,o=%s %.4o Illegal number: %sCannot set mode `%s' (%s)HSabtfdscmlrpnvtoo many argumentsunlimited%-13s (-%c %-11s) unlimited error getting limit (%s)error setting limit (%s)internal error (%c)kbytesstacklocked memorythreadthreadsnofilesvmemorysbsizeIllegal number: '%s'Number out of range: %sCurrent option settings%s%c%c%-19s %s set -o defaultIllegal option %co %s+-Illegal option %c%carg for %co missingBad -c optionUsage: shift [n]can't shift that manyOPTARGIllegal option -%c No arg for -%c option OPTINDusage: getopts optstring var [arg]Illegal option -%cNo arg for -%c optionallexportcdprintemacserrexitignoreeoflocal_linenomonitornoclobbernoglobnolognoprivnotifynounsetpipefailpromptcmdsquietprofiletabcompletetrackallxtrace%d: Syntax error: %sBad fd numberWord "%.13s" unexpectedWord "%.10s..." unexpected%s unexpected (expecting "%.10s") (expecting %s)huge prompt: No mem for prompt: Illegal eof marker for << redirectionEOF in backquote substitutionUnterminated quoted string ($'...)Bad \c escape sequenceBad \c\ escape sequenceInvalid \u escape sequenceUnknown $'' escape sequenceMissing '))'Unterminated quoted stringMissing '}'Bad substitutionno modifiers allowed with ${#var}-o promptcmds not set: Bad for loop variableBad function name2nd "!" unexpected%d: Here document (<<%s) expected but not presentthenelseelifwhileuntilnewline";""&""&&""||""|""("")"";;"";&""`""if""then""else""elif""fi""while""until""for""do""done""{""}""case""esac""!"Redirect (from %d to %d) failed: %sredirect reassignment (fd %d) failed: %scannot create %s: %sUnable to make fd %d: %sBad file descriptorCan't get status for fd=%d (%s)Can't get flags for fd=%d (%s) +%#xinsufficient file descriptors availableUsage: fdflags [-v] [-s fd] [fd...]:vs:Missing +/- indicator before flag %s%s too big to be a file descriptorCan't set status for fd=%d (%s)Can't set flags for fd=%d (%s)Bad flag `%s''...'<<nonblockfsyncdsyncrsyncaltiodirectnosigpipecloexecEXITtrap -- -trap -- ''trap -- Usage: trap [-l] trap -p [condition ...] trap action condition ... trap N condition ... trap: '%s' bad condition Could not allocate formatted output buffer\"$`Usage: %s [ -p | var[=val]... ]Usage: %s [ -p | [-n] var[=val]... ]%.*s=%d|&;<>()$`\"' *?[]#~=%\''%.*s'%.*s: is read only%.*s: bad variable namePS1=$ PS1=# PScPS1%.*s: not available for export%s: bad variable nameefvxList assignment not implementedNot in a functionINxIFS= MAIL=MAILPATH=NETBSD_SHELL=PATH=/usr/bin:/bin:/usr/pkg/bin:/usr/local/binPS2=> PS4=+ OPTIND=1LINENO=1%s: out of range'%s': bad number!=missing ]SMALL test, no fallback usageeqgtunknown signal %s; valid signals:usage: %s [-s signal_name] pid ... %s -l [exit_status] %s -signal_name pid ... %s -signal_number pid ... illegal signal number: %sunknown signal number: %doption requires an argument -- sillegal job id: %sillegal process%s id: %sevalreturnshifttrapbgchdirletfcinputrcgetoptshashprintffdflagssetvarumaskunaliasulimittestwordexpPPID20181212 BUILD:20210512131555Z SMALLNETBSD_SHELLUsage: %s format [arg ...] incomplete escape sequenceunknown escape sequence `\%c'format %s too complex%s: expected numeric value%s: not completely converted%s: invalid field width#-+ 0'%s: missing format character%s: invalid directiveprint failed\\ Y\\X^\\\ \  c \ "^8_\:x<]$<]<J<];_`;]<^=]L=o]=IO >^; >|],>]0?d?= >]<];,\>p]p> 1>B^F^J^N^S^#R^3[^#Z^3b^2a^3h^3g^#____ _@$@____3^2^5_=_L_T_E_^ _@____;^%_,_ ]C$]C]C$]C;^^^ ^^^^^^}^^^@!^@^ )^ w^o^^^@^^ ^]]]]\_c_j_q_y_ _@option requires an argument -- %sundefvalue of %ld would disable the option -- %smaximum option value is %d -- %soption requires a numeric argument -- %srprntdiscarddsuspeoleol2lnextminquitreprintillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d %lxcflagispeedlflagospeedTIOCSETDTIOCSTARTTIOCSTOPillegal option -- %scbreakcolscookedeverythinginsaneostartrows-litout-tabs-crt-newcrt-kerninfocrterasecrtbscrtkillctlechoprterase-decctlqtandemcs5cs6cs7cs8-parity-evenp-oddp-pass8-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-istrip-icrnl-inlcr-igncr-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrk-opost-onlcr-ocrnl-oxtabs-onocr-onlret-cread-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbuf-cdtrctsispeed %d baud; ospeed %d baud; %d rows; %d columns; queue = %d; line = %s;lflagsiflagsoflagscflagscchars%s = %s;%-8susage: %s [-a|-e|-g] [-f file] [operand ...] -aefgaef:gTIOCGLINEDtcgetattrTIOCGWINSZTIOCGQSIZEgfmt1tcsetattrTIOCSWINSZowner:group|owner|:groupUsage: %s [-R [-H | -L | -P]] [-fhv] %s file ... %s [-R [-H | -L | -P]] [-fhv] --reference=rfile file ... %s: invalid %s nameHLPRfhvthe -L and -h options may not be specified together.sssstt%t8tZtgttttt=t'v/v7v@ u@=v@Ev@Lv@Tv@]v@bv@gv@nv@}u @sv@yv@v@v@vvvvvvvvuvvvvvvvvvv@w@ wwww)w0w6wv MAXPARTITIONS (%d)warning, partition %c increased number of partitions from %u to %dwarning, partition %c: size 0, but offset %upartition %c: offset past end of unitpartition %c: partition extends past end of unitpartitions %c and %c overlapdeleted ignoring %sbyteswapped label at offset %jd from sector %ucorrupt label found at offset %jd in sector %u%slabel found at offset %jd from sector %u# %ssector %u offset %jd bytes failed to read bootarea from sector %uread sector %u len %d looking for labelno space in bootarea (sector %u) to create label# line %d: warning, unknown disk type: %sline %d: bad flag: %sdrivedataline %d: bad drive data%lu partitionsline %d: bad # of partitionsbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindertotal sectorssectors/unitrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: unknown field: %sline %d: bad partition name: %sline %d: partition id %s, >= %zuline %d: warning, unknown file system type: %stip: use -l to see all valid file system typessorry, could not allocate memory for listcould not read existing labelioctl DIOCGDINFOioctl DIOCSDINFOioctl DIOCWLABELioctl DIOCWDINFO/usr/bin/viMACHINE%s: unknown arch%s: not be or leinvalid label sector: %sinvalid label offset: %sinvalid max partitions: %sAB:CDFIL:M:NO:P:RWef:ilmnrtvwtoo large maxpartitions > %u unknown label: use -M/-B and $MACHINE/$MACHINE_ARCHunknown byteorderEdDk.aXXXXXXEDITORmallocre-edit the label? [y]: [-ABCFMrtv] disk(to read label)-w [-BDFMrv] [-f disktab] disk disktype [packid](to write label)-e [-BCDFMIrv] disk(to edit label)-i [-BDFMIrv] disk(to create a label interactively)-D [-v] disk(to delete existing label(s))-R [-BDFMrv] disk protofile(to restore label)[-NW] disk(to write disable/enable label)(to show all known file system types)aarch64alphaearmearmhfearmv4earmv5earmv6earmv6hfearmv7earmv7hfi386ia64mipselmips64elriscv32riscv64sh3elvaxx86_64aarch64ebcoldfireearmebearmhfebearmv4ebearmv5ebearmv6ebearmv6hfebearmv7ebearmv7hfebhppam68000m68kmipsebmips64ebor1kpowerpcsh3ebsparcsparc64mvme68knext68kalgorluna68kmac68knews68knewsmipspmaxsun2sun68kx68kamigaamigappcevbmipsevbppcsun3atarimipscomvmeppcbeboxemipsibmnwsofppcrs6000sandpointsgimipssbmipscesfichp300ews4800mipsmacppcpmonprepdreamcastevbcfevbppc-mbrevbsh3hpcshmmeyeriscvacorn32catsevbarmiyonixnetwindersharkamd64cobaltlandiskepoc32hpcarmhpcmipszaurusVersion 6Version 7System V4.1BSDEighth Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSFILECORELinux Ext2NTFSccdjfsApple UFSUDFSysVBFSEFSNiLFSMINIX FSv3VMware vmkcoreVMware VMFSVMware ReservedSMDMSCPold DECESDIST506HP-IBHP-FLtype 9floppyvndATAPIflashrumpd%s %s [a-%c] define named partition Rounding [%s]: Rounding can be (c)ylinders or (s)ectorsAutomatically adjust partitions [%s]? Invalid answerLabel disk [n]?Label not writtenLabel writtenLabel name [%.*s]: Cannot get default labelAdjust disklabel sector from %u to %u [n]? Already at %u sectors %.40gc, %us, %.40gMUnit error %c Valid units: (S)ectors, (C)ylinders, (K)ilo, (M)ega, (G)iga, (T)era# Current values:Disk type [%s]: Supported disk typesUnknown disk type: %sDisk name [%.*s]: Number of partitions [%u]: Invalid number of partitions `%s' Sector size (bytes) [%u]: Invalid sector size `%s' Number of sectors per track [%u]: Invalid number of sectors `%s' Number of tracks per cylinder [%u]: Invalid number of tracks `%s' Number of sectors/cylinder [%u]: Invalid number of sector/cylinder `%s' Total number of cylinders [%u]: Total number of sectors [%u]: Hardware sectors interleave [%u]: Invalid sector interleave `%s' Sector 0 skew, per track [%u]: Invalid track sector skew `%s' Sector 0 skew, per cylinder [%u]: Invalid cylinder sector `%s' Head switch time (usec) [%u]: Invalid head switch time `%s' Track seek time (usec) [%u]:Invalid track seek time `%s' Enter '?' for helppartition>Filesystem type [%s]: Supported file system typesInvalid file system typename `%s' Start offset ('x' to start after partition 'x') [%s]: Bad offset `%s' Offset `%s' out of range Partition size ('$' for all remaining) [%s]: Bad size `%s' Size `%s' out of range Unknown command %s print this menuadjust the label size to the max disk sizemake partitions contiguousprint disk label and current partition tablechange label informationlist all known file system typesname the labelprint current partition tablerounding (c)ylinders (s)ectorswrite the current partition table# %s: type: %u disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %u rpm: %u interleave: %u trackskew: %u cylinderskew: %u headswitch: %u # microseconds track-to-track seek: %u # microseconds drivedata: %u/%u/%u %c: %9s %9s %c: %9u %9u %10.10s%10u %5u %5llu %5.5s %5u %5llu %5u %5u %5llu %6u %20.20s # (Cyl. %6u- %6u%u partitions: # size offset fstype [fsize bsize cpg/sgs] wփUsage: %s device %s device command [arg [...]] Available commands: rwnot %s: getcache%s: No caches enabled %s: read cache enabled %s: write-back cache enabled %s: read cache enable is %schangeable %s: write cache enable is %schangeable %s: cache parameters are %ssavable %s: cache Force Unit Access (FUA) %ssupported %s: cache Disable Page Out (DPO) %ssupported %s: DIOCGSTRATEGY%s: DIOCSSTRATEGY%s: %s -> %s qe%s: listwedges%s: listwedges: unable to allocate wedge info buffer%s: no wedges configured %s: %u wedge%s: %s: %s, %llu blocks at %lld, type: %s %s: badsectors list%s: blocks %lld - %lld failed at %s%s: badsectors flushfstatwith character device'badsector retry' must be used %s %s: bad sector clusters %lld total sectors %lld %s: bad sectors flushed %s: Retrying %lld - %lld %s: lseek block %lld%s: block %lld - Wedge name too long; max %zd charactersWedge partition type too long; max %zd charactersInvalid start block: %sStart block out of range.Start block must be >= 0.Invalid block count: %sBlock count out of range.%s created successfully. forcesuccessfully scanned %s. %s: getwedgeinfo%s at %s: %s %s: %llu blocks at %lld, type: %s Wedge dk name too long; max %zd charactersunknown command: %sstrategyaddwedgename startblk blkcnt ptypebadsectorflush | list | retrydelwedgedkkeeplabelyes | nosetcachenone | r | w | rw [save][name]synccache[force]Usage: %s -r [-a attribute] busdevice [locator ...] %s -d device %s [-nt] -l [device] %s [-n] -p device [property] %s -Q device %s -R device %s -S device DRVLISTDEVDRVLISTDEV: number of children grewArray:Unhandled type %dQRSa:dlnprt/dev/drvctlDRVRESUMEDEVDRVSUSPENDDEVDRVDETACHDEVmalloc int[%d]DRVRESCANBUSget-propertiesdrvctl-commanddevice-namedrvctl-argumentsDRVCTLCOMMANDdrvctl-errordrvctl-result-dataget-properties: failed to return result dataProperties for device `%s': Select neither dict nor array with `%s'unknown command `%c'nԡ5   ٢  '>ԢSr #;W s!C #C $&C 1C 23C 4C 56C 899:ؤ;<=(@7AKBCDڥEFGHJL8MINPO`PpQRSTU¦VڦW\ac#d^efghipqC sC tC uħvC wʧxާ 5Tavب,Ia{©ީ#?Y_xxxxͪ%0C C C C :Rd}pƫ ---Fe|ά;Cuĭ߭@C C ty C ήC BUhtǯ/%lu/%luusage: %s [-aBFfIilSuv] [-A ptn_alignment[/ptn_0_offset]] \ %*s[-b cylinders/heads/sectors] \ %*s[-0123 | -E num [-s [id][/[start][/[size][/bootmenu]]]] \ %*s[-t disktab] [-T disktype] \ %*s[-c bootcode] [-r|-w file] [-z sectorsize] [device] -a change active partition -f force - not interactive -i initialise MBR code -I ignore errors about no space or overlapping partitions -l list partition types -u update partition data -v verbose output, -v -v more verbose still -B update bootselect options -F treat device as a regular file -S output as shell defines -r and -w access 'file' for non-destructive testing read_disk(); fd == -1Can't read %s partition table%s partition table invalid, no magic in sector %lldsecondaryCan't read %s GPT headerEFI PARTFound %s GPT header CRC %u at sector %lld, backup at %lld decimal%s: [%lld..%lldcyl default: %lld, %lldcyl, %uMB] %s: [%lld..%lld default: %lld] gbcyl%s is not a valid %s number. %lld is not between %lld and %lld. realloc [n] write_disk(); wfd == -1Can't write fdisk partition tableCan't write bootcodeCan't write %dth extended partitionDISK=%s DLCYL=%d DLHEAD=%d DLSEC=%d DLSIZE=%lld BCYL=%d BHEAD=%d BSEC=%d BDLSIZE=%lld NUMEXTPTN=%d Disk: %s NetBSD disklabel disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld, bytes/sector: %zd BIOS disk geometry:cylinders: %d, heads: %d, sectors/track: %d (%d sectors/cylinder) total sectors: %lld Partitions aligned to %d sector boundaries, offset %d Sector zero is reserved for the MBRPartition exceeds size of diskOverlaps another partitionThere cannot be 2 extended partitionsExtended partition busyExtended partition outside main partitionMalloc failedDo you really want to delete all the extended partitions?Nested extended partitions are not allowedOutside bounds of extended partitionOverlaps another extended partitiongiven GPT header location doesn't seem correctcan't delete %s GPT headerPBR is not bootableNot bootable%s (sysid %d) %*s start %lld, size %lld (%u MB, Cyls , Active, flag 0x%x%*s beg: cylinder %4d, head %3d, sector %2d %*s end: cylinder %4d, head %3d, sector %2d %*sInformation from PBR: %*s%s: Sector %lld is unreadable (%s) All bytes are identical (0x%02x) Bad magic number (0x%04x) %*sPBR appears to be bootable OEM name%*s%s: "%s" %*sBPB FAT16 boot signature found %*sBPB FAT32 boot signature found %*s Extended partition table: %*s%d: PART%s%dSIZE=0 PART%s%dID=%d PART%s%dSIZE=%u PART%s%dSTART=%lld PART%s%dFLAG=0x%x PART%s%dBCYL=%d PART%s%dBHEAD=%d PART%s%dBSEC=%d PART%s%dECYL=%d PART%s%dEHEAD=%d PART%s%dESEC=%d The data for partition %s%d is: No space in extended partitionNo free spacesysidStart sector already allocatedExplicitly specify beg/end address?beginning cylinderbeginning headbeginning sectorending cylinderending headending sectorPartition table:Extended partition table is corruptExtended partition table:E%d: link: No active partition.First active partition: %d Drive serial number: %u (0x%08x) Extended partition E%d: UndefinedPartition %d: Bad partition number -E %s.%03d %s %d/%d/%d%nBad argument to the -b flag.%u%n/%u%nBad argument to the -A flag.%s: bootcode too large%s: bootcode too small%s: invalid magicbad disktabInvalid sector size %zd0123FSafiIluvA:b:c:E:r:s:w:z:bad disktypeBootselector may only be configured interactivelyPartition data not specified-s flag requires a partition selected.%s is not a character devicecannot opendisk %s%s size (%lld) is not divisible by sector size (%d)DIOCGDEFLABELCannot allocate %zd bufferCannot determine the number of headsCannot determine the number of sectorsExtended partition %d is not defined.Do you want to change our idea of what BIOS thinks?BIOS's idea of #cylindersBIOS's idea of #headsBIOS's idea of #sectorsAre you happy with this choice?Which partition do you want to change?%s: [none] %s is not a valid partition number. Do you want to change the active partition?Choosing %d will make no partition active. active partitionMaking partition %d active. We haven't written the MBR back to disk yet. This is your last chance. WARNING: The disk is carrying GUID Partition Tables. If you continue, GPT headers will be deleted. Should we write new partition table?Primary GPT header was deletedSecondary GPT header was deletedBad argument to the -s flag./usr/mdec/dev/rwd0dPrimary DOS with 12 bit FATXENIX / filesystemXENIX /usr filesystemPrimary DOS with 16 bit FAT <32MExtended partitionPrimary 'big' DOS, 16-bit FAT (> 32MB)NTFS, OS/2 HPFS, QNX2 or Advanced UNIXAIX filesystem or OS/2 (thru v1.3) or DELL multiple drives or Commodore DOS or SplitDriveAIX boot partition or CoherentOS/2 Boot Manager or Coherent swap or OPUSPrimary DOS with 32 bit FATPrimary DOS with 32 bit FAT - LBAType 7??? - LBADOS (16-bit FAT) - LBAExt. partition - LBAOS/2 BM: hidden DOS 12-bit FATCompaq diagnosticsOS/2 BM: hidden DOS 16-bit FAT <32M or Novell DOS 7.0 bugOS/2 BM: hidden DOS 16-bit FAT >=32MOS/2 BM: hidden IFSAST Windows swapfileWillowtech Photon coShidden Windows/95 FAT32hidden Windows/95 FAT32 LBAhidden Windows/95 FAT16 LBAWillowsoft OFS1NEC DOSAlien Internet Services NOSJFS on OS2TheosPlan 9Plan 9, or Theos spannedTheos ver 4 4gb partitionTheos ve 4 extended partitionPartitionMagic recoveryHidden NetwareVENIX 286 or LynxOSLinux/MINIX (sharing disk with DRDOS) or Personal RISC bootSFS or Linux swap (sharing disk with DRDOS)Linux native (sharing disk with DRDOS)GoBack change utilityBoot US Boot managerEUMEL/Elan or Ergos 3ALFX/THIN filesystem for DOSOberon partitionQNX4.xQNX4.x 2nd partQNX4.x 3rd partDM (disk manager)DM6 Aux1 (or Novell)CP/M or Microport SysV/ATDM6 Aux3DM6 DDOEZ-Drive (disk manager)Golden Bow (disk manager)Drive PROPriam Edisk (disk manager)SpeedStorGNU HURD or Mach or Sys V/386 (such as ISC UNIX) or MtXinuNovell Netware 2.xx or SpeedstoreNovell Netware 3.xxNovell 386 NetwareNovellDiskSecure Multi-BootPC/IXM2FS/M2CS partitionXOSL boot loader filesystemMINIX until 1.4aMINIX since 1.4b, early Linux, Mitac dmgrLinux swap or Prime or SolarisLinux nativeOS/2 hidden C: driveLinux extendedNT FAT volume setNTFS volume set or HPFS mirroredLinux Kernel AiR-BOOT partitionLegacy Fault tolerant FAT32Legacy Fault tolerant FAT32 extHidden free FDISK FAT12Linux Logical Volume ManagerHidden free FDISK FAT16Hidden free FDISK DOS EXTHidden free FDISK FAT16 LargeAmoeba filesystemAmoeba bad block tableMIT EXOPC native partitionsHidden free FDISK FAT32Datalight ROM-DOS Super-BootMylex EISA SCSIHidden free FDISK FAT16 LBAHidden free FDISK EXT LBABSDI?IBM Thinkpad hibernationHP Volume expansion (SpeedStor)FreeBSD or 386BSD or old NetBSDOpenBSDNeXTSTEP 486Olivetty Fat12 1.44MB Service partSHAG OS filesystemBootStar DummyBoot Wizard HiddenApple BootApple HFSBSDI BSD/386 filesystemBSDI BSD/386 swapSolaris 8 boot partitionSolaris boot partitionDRDOS/sec (FAT-12)Hidden LinuxHidden Linux SwapDRDOS/sec (FAT-16, < 32M)DRDOS/sec (EXT)DRDOS/sec (FAT-16, >= 32M)Syrinx (Cyrnix?) or HPFS disabledReserved for DR-DOS 8.0+DR-DOS 7.04+ Secured FAT32 CHSDR-DOS 7.04+ Secured FAT32 LBADR-DOS 7.04+ FAT16X LBADR-DOS 7.04+ EXT LBAREAL/32 secure big partitionOld Multiuser DOS FAT12Old Multiuser DOS FAT16 SmallOld Multiuser DOS ExtendedOld Multiuser DOS FAT16 BigCP/M 86CP/M or Concurrent CP/M or Concurrent DOS or CTOSHidden CTOS MemdumpDell PowerEdge Server utilitiesDG/UX virtual disk managerSTMicroelectronics ST AVFSDOS access or SpeedStor 12-bit FAT extended partitionDOS R/O or SpeedStor or Storage DimensionsSpeedStor 16-bit FAT extended partition < 1024 cyl.BeOSGPT Protective MBREFI system partitionLinux PA-RISC boot loaderDOS 3.3+ SecondarySpeedStor large partition or Storage DimensionsPrologue multi-volumen partitionpCache: ext2/ext3 persistent cacheBochs x86 emulatorVMware File SystemVMware SwapLinux RAID partition persistent sbSpeedStor >1024 cyl. or LANstep or IBM PS/2 IMLXenix Bad Block Table[-dfnPpqvy] [-x excludemount] [-l maxparallel] [-T fstype:fsoptions] [-t fstype]r_wwwwwwwwAbwww6wx xxxx#x'x/x3x9xDxSx_xreturning to single-user after filesystem check rq-ostart %s %swaitvfork%s: file system is mounted read-write on %s; not checking exec %s for %sInvalid option stringusage: %s %s [special|node]... dfl:nPpqT:t:vx:y/dev/%s has unknown file system type.cannot open `%s'cannot get disklabel for `%s'partition `%s' is not defined on diskpartition `%s' is not of a legal vfstypevfstype `%s' on partition `%s' is not supported/usr/sbin** %s (vmsg) %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat `/'Can't stat `%s'Can't convert to raw `%s'%s is not a character device Can't convert to cooked `%s'%12.12s %4.4s %lld /etc/fstabCan't open checklist file: %spass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s:done %s: %s (%s) = 0x%x %s: %s (%s): EXITED WITH SIGNAL %d UNEXPECTED INCONSISTENCY:THE FOLLOWING FILE SYSTEM%s HAD AN %s %s: %s (%s)%sUnknown pid %dreadDosDirSectionreturning to single-user after filesystem check Usage: %s [-fnpy] [-x snap_backup] filesystem ... pPqynfx:Cannot use -x without -ncan't take snapshot of %sFIXED%s? %s %s? [yn] ** %sCan't open `%s'** Phase 1 - Read and Compare FATs** Phase 1 - Read FAT** Phase 2 - Check Cluster Chains** Phase 3 - Checking Directories** Phase 4 - Checking for Lost FilesUpdate FATs%d files, %d free (%d clusters), %d bad (%d clusters) %d files, %d free (%d clusters) MARK FILE SYSTEM CLEANMARKING FILE SYSTEM CLEAN ***** FILE SYSTEM IS LEFT MARKED AS DIRTY ***** ***** FILE SYSTEM WAS MODIFIED ***** could not read boot blockInvalid signature in boot block: %02x%02xInvalid cluster size: %u Invalid number of FATs: %u Unknown filesystem version: %x.%xcould not read fsinfo blockRRaArrAaInvalid signature in fsinfo blockUnable to write FSInfocould not read backup bootblockbackup (block %d) mismatch with primary bootblock: i=%d primary 0x%02x backup 0x%02x Invalid number of FAT sectors: %u Invalid sector size: %uInvalid cluster size: %uCluster offset too large (%u clusters) Filesystem too big (%u clusters) for non-FAT32 partitionFAT size too small, %u entries won't fit into %u sectors Cluster %u in FAT %u continues with %s cluster number %u TruncateNo space for FAT sectors (%zu)Unable to read FATNo space for FAT clusters (%zu)FAT starts with odd byte sequence%s (%02x%02x%02x%02x%02x%02x%02x%02x) %s (%02x%02x%02x%02x) %s (%02x%02x%02x) Correctas EOFbadCluster %u is marked %s with different indicators, Cluster %u is marked %s in FAT 0, %s in FAT %u use FAT 0's entryuse FAT %u's entryCluster %u is marked %s in FAT 0, but continues with cluster %u in FAT %u Use continuation from FAT %uUse mark from FAT 0Cluster %u continues with cluster %u in FAT 0, but is marked %s in FAT %u Use continuation from FAT 0Use mark from FAT %uCluster %u continues with cluster %u in FAT 0, but with cluster %u in FAT %u Clear chain starting at %uCluster chain starting at %u ends with cluster marked %s Cluster chain starting at %u ends with cluster out of range (%u) Cluster chain starting at %u loops at cluster %u Cluster chains starting at %u and %u are linked at cluster %u Unable to write FATLost cluster chain at cluster %u %d Cluster(s) lost ClearFree space in FSInfo block (%u) not correct (%u) Next free cluster in FSInfo block (%u) %s Unable to read directoryUnable to write directory%s has entries after end of directory Extendq != NULL/usr/src/sbin/fsck_msdos/dir.clong filename too long long filename record cluster start != 0 Invalid long filename entry for volume label RemoveInvalid long filename entry for %s %s has clusters, but size 0 Drop allocated clusters%s has no clusters %s starts with cluster out of range(%u) %s starts with free cluster %s starts with cluster marked %s %s doesn't start a cluster chain Directory %s has size != 0 `.' entry in %s has incorrect start cluster `..' entry in %s has non-zero start cluster `..' entry in %s has incorrect start cluster No space for directoryNo space for todo listsize of %s is %u, should at most be %u %s has too many clusters allocated Drop superfluous clustersInvalid long filename entry at end of directory %s No space for directory buffer (%zu)No space for directory delbuf (%zu)No space for directory entryRoot directory starts with cluster out of range(%u)Root directory starts with free cluster Root directory starts with cluster marked %s Root directory doesn't start a cluster chainFixReconnectNo space for bufferNo space in %s could not read LOST.DIRcould not write LOST.DIRNo %s directory %.*s/%s%s/XXXXXXXXXX/dev/rfss%dreturning to single-user after filesystem check          @    !     !@*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ>~?wapbl_circ_readwapbl_circ_advancewapbl_blkhash_clearwapbl_blkhash_freewapbl_replay_freewapbl_space_usedwapbl_blkhash_initwapbl_blkhash_inswapbl_blkhash_remwapbl_replay_writewapbl_replay_can_readwapbl_replay_readuntitledBad dir: ino %d reclen %d namlen %d type %d name %s DIRECTORY CORRUPTEDNO SPACE LEFT IN %s (EXPANDED)EXPANDwrong type to dirscan %dNAME=%s UNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu UNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTlost+foundbad size: blk %lld, offset %d, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock->fs_fpg %d bad inode number %llu to ginodebad inode number %llu to nextinodebad inode number %llu to setinodebufCannot allocate space for inode buffercannot increase directory listcannot find inode %lluPARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS I=%llu OWNER=MODE=%o SIZE=%llu MTIME=%s CLEAR (CLEARED)%lld %s I=%lluBAD STATE %d TO BLKERRcannot alloc %lu bytes to extend inoinfo CG %d: ALLOCINO: BAD MAGIC NUMBER CG %d: FREEINO: BAD MAGIC NUMBER bad ofsset %llu to readblkbad filesize %llu to expandfileINTERNAL ERROR: expandfile() failed to allocate a new block usage: %s [-adFfPpqUX] [-B byteorder] [-b block] [-c level] [-m mode] [-x snap-backup] [-y | -n] filesystem ... -%c flag requires a %s** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p INTERNAL ERROR: dups with softdep ** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups ** Phase 6 - Check Quotas %llu files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %llu files missing %lld blocks missing The following duplicate blocks remain: %lld,The following zero link count inodes remain: %llu, ***** UNRESOLVED INCONSISTENCIES REMAIN ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW ***** starting CAN'T CHECK FILE SYSTEM.Alternate super block location: %d conversion levelUsing maximum conversion level of %dbad mode to -m: %o** lost+found creation mode %o aB:b:c:dFfm:npPqUyx:XzCannot use -x or -X without -nCan't check %s EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%llubad size %llu:HOLD BAD BLOCKbad size %llu ndb %lld:cannot read symlinkconvert symlink %llu(%s) of size %lld bad direct addr ix %d: %d [ndb %lld] bad direct addr ix %d: %lld [ndb %lld] bad indirect addr: %d bad indirect addr: %lld LINK COUNT TABLE OVERFLOWINCORRECT BLOCK COUNT I=%llu (%lld should be %lld) (CORRECTED)UNKNOWN FILE TYPE I=%llu%s: phase 1: cyl group %d of %d (%d%%) CG %d: BAD MAGIC NUMBER too many inodes %llu cannot alloc %zu bytes for inoinfo cannot realloc %zu bytes to %zu for inoinfo %s: phase 1b: cyl group %d of %d (%d%%) DUP/BADZERO LENGTH DIRECTORYBAD INODE NUMBER FOR '.'FIXBAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'MISSING '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYIS AN EXTRANEOUS HARD LINK TO DIRECTORY%s %s %s (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%dROOT INODE UNALLOCATEDCANNOT ALLOCATE ROOT INODEDUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYBAD STATE %d FOR ROOT INODE%s: phase 2: dir %ld of %d (%d%%) DIRECTORY TOO SHORT%s %s: LENGTH %lld NOT MULTIPLE OF %dBAD INODE NUMBER FOR '..'%s: phase 3: dir %d of %d (%d%%) ORPHANED DIRECTORY LOOP DETECTED I=%luCOULD NOT FIND NAME IN PARENT DIRECTORYCG %d: ALLOCBLK: BAD MAGIC NUMBER %s: phase 4: cyl group %d of %d (%d%%) skipping unreferenced journal inode %lld skipping unreferenced quota inode %lld ZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%lluCREATDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS cannot reallocate cg spaceUNKNOWN ROTATIONAL TABLE FORMAT %d%s: phase 5: cyl group %d of %d (%d%%) CG %d: PASS5: BAD MAGIC NUMBER CG %d: UNABLE TO READ ALTERNATE SUPERBLK ALTERNATE SUPERBLK(S) ARE INCORRECTBAD STATE %d FOR INODE I=%ldcg %d: nffree: %d/%d nbfree %d/%d nifree %d/%d ndir %d/%d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %ld MARKED FREE ALLOCATED FRAG %ld MARKED FREE BLK(S) MISSING IN BIT MAPStotal: nffree: %lld/%lld nbfree %lld/%lld nifree %lld/%lld ndir %lld/%lld %u: %2x CLEAR USER QUOTA INODECLEAR GROUP QUOTA INODE%s QUOTA INODE CLEARED CLEAR SUPERBLOCK QUOTA FLAGSUPERBLOCK QUOTA FLAG CLEAREDUSERGROUPBAD SUPER BLOCK: %s MAGIC NUMBER WRONGIncompatible options -B and -pIncompatible options -B and -nCONVERT TO LITTLE ENDIANCONVERT TO BIG ENDIANINTERNAL ERROR: unknown endian** Swapped byte order SIZE PREPOSTEROUSLY LARGEVALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATEsuperblock mismatchesoffset %#x, original 0x%08x, alternate 0x%08x CAN'T FIND SUPERBLOCK** FCan't stat %s: %s Can't open %s: %s NO WRITE ACCESS** %s (NO WRITE) ** %s Cannot allocate space for superblock%s: CANNOT FIGURE OUT FILE SYSTEM PARTITION appleufs%s: NOT LABELED AS A BSD FILE SYSTEM (%s) %s: CANNOT FIGURE OUT SECTOR SIZE %s: CANNOT FIGURE OUT SECTORS PER CYLINDER %s: CANNOT FIGURE OUT FRAG BLOCK SIZE %s: CANNOT FIGURE OUT FRAGS PER GROUP %s: CANNOT FIGURE OUT OLD CYLINDERS PER GROUP LOOK FOR ALTERNATE SUPERBLOCKS-b OPTION TO fsck_ffs TO SPECIFY THEFAILED. YOU MUST USE THESEARCH FOR ALTERNATE SUPER-BLOCK%s %s %s %s %s %s INFORMATION; SEE fsck_ffs(8).SUPER-BLOCK TO SUPPLY NEEDEDLOCATION OF AN ALTERNATEUSING ALTERNATE SUPERBLOCK AT %d file system is journaled; not checking ** File system is journaled; replaying journal clean = %d %sile system is clean; not checking ** File system is already clean CONVERTING TO NEW SUPERBLOCK LAYOUT CONVERT TO NEW SUPERBLOCK LAYOUTDOWNGRADING TO OLD SUPERBLOCK LAYOUT DOWNGRADE TO OLD SUPERBLOCK LAYOUTUNKNOWN FLAGS=0x%08x IN SUPERBLOCKUNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED)IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=0x%x IN SUPERBLOCKINCORRECT FMASK=0x%x IN SUPERBLOCKSNAPSHOT INODE %u ALREADY ON LIST%sINCORRECT MAXFILESIZE=%lld IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%#llx IN SUPERBLOCKINCORRECT QFMASK=%#llx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for summary info BAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for inostathead cannot alloc %u bytes for inphead cannot alloc %u bytes for cylinder group MISSING APPLEUFS VOLUME LABEL INCORRECT APPLE UFS VERSION NUMBER (%d should be %d)APPLE UFS LABEL NAME TOO LONG (TRUNCATED)TRUNCATEMISSING APPLE UFS LABEL NAMEAPPLE UFS LABEL NAME CONTAINS ILLEGAL CHARACTERINVALID APPLE UFS CHECKSUM (%#04x should be %#04x)isappleufs = %d, dirblksiz = %d quota hash shift %d, %d entries, mask 0x%x Cannot allocate space for quotas hash bad file type 0%o INTERNAL ERROR: GOT TO reply()%s? no %s? yes CANNOT %s: BLK %lldcannot allocate buffer poolREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %lld (%lld),THE FOLLOWING SECTORS COULD NOT BE WRITTEN:PARTIALLY WRITING %sZERO'ED BLOCK %lld TO DISK deadlocked buffer pool (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %dinoinfo: inumber %llu out of rangecannot allocate space for compat storedetected ufs1 superblock not yet updated for ufs2 kernelsUPDATE STANDARD SUPERBLOCKUPDATING STANDARD SUPERBLOCK Panic: lost %d buffers ***** FILE SYSTEM MARKED CLEAN *****cache missed %ld of %ld (%d%%) cannot allocate quota entryffs_isblock: unknown fs_fragshift %dffs_isfreeblock: unknown fs_fragshift %dffs_clrblock: unknown fs_fragshift %dffs_setblock: unknown fs_fragshift %dunknown disk type `%s'DIOCGDINFO on %s failedgeometrysectors-per-unitsector-sizesectors-per-tracktracks-per-cylindercylinders-per-unitPlease implement DIOCGWEDGEINFO or DIOCGDINFO for disk device %sDUPLICATE QUOTA ENTRYQUOTA uid %d IN WRONG HASH LIST %dCAN'T READ QUOTA BLOCK%s QUOTA MISMATCH FOR ID %d: %llu/%llu SHOULD BE %llu/%lluSORRY, CAN'T EXPAND QUOTA INODE INTERNAL ERROR: addfreeq2e didn't fill free list CAN'T READ QUOTA BLOCK %s QUOTA INODE %llu IS A DIRECTORYUNALLOCATED %s QUOTA INODE %lluINTERNAL ERROR: wrong quota inode %llu type %d WRONG TYPE %d for %s QUOTA INODE %lluCORRUPTED %s QUOTA INODE %lluNO %s QUOTA INODEcan't re-read %s quota header QUOTA ENTRY NOT IN LISTcan't read %s quota entry %s QUOTA MISMATCH FOR ID %d: 0/0 SHOULD BE %llu/%llu (ALLOCATED)ALLOCInvalid quota magic number no user quota inode no group quota inode ((len >> wr->wr_log_dev_bshift) << wr->wr_log_dev_bshift) == len/usr/src/sys/kern/vfs_wapbl.cwr->wr_blkhashcnt > 0wr->wr_blkhashcnt == 0wapbl_replay_stop called!((wr)->wr_scratch != 0)wapbl_replay_start: vp=%p off=%lld count=%zu blksize=%zu Unrecognized wapbl magic: 0x%08x head == 0wapbl_replay: head=%lld tail=%lld off=%lld len=%lld used=%zu wr->wr_blkhash == 0wb->wb_blk == blkUnrecognized wapbl type: 0x%08x wapbl_replay: corrupted records(len % fsblklen) == 0wapbl_write: %zd bytes at block %lld on fd 0x%x wapbl_read: %zd bytes at block %lld on fd 0x%x UNABLE TO REPLAY JOURNAL BLOCKSwapbl_replay: not cleaning inode %u mode %o INVALID JOURNAL VERSION %dCLEARING EXISTING JOURNAL INVALID JOURNAL LOCATION %dUNABLE TO READ JOURNAL FOR REPLAYCLEARING JOURNAL FLAGS INVALID JOURNAL FLAGS %d0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z- )W`$3   % 8 M _ s  k&`m&k&k&l&l&4l&Pl&hl&l&l&l&xm&l&l&m&$m&Dm&0_wwwwwwwwAbwww6wx xxxx#x'x/x3x9xDxSx_xnԡ5   ٢  '>ԢSr #;W s!C #C $&C 1C 23C 4C 56C 899:ؤ;<=(@7AKBCDڥEFGHJL8MINPO`PpQRSTU¦VڦW\ac#d^efghipqC sC tC uħvC wʧxާ 5Tavب,Ia{©ީ#?Y_xxxxͪ%0C C C C :Rd}pƫ ---Fe|ά;Cuĭ߭@C C ty C ήC BUhtǯSFH0eC0SFU0eC%xHah!IdontNeedEFI/4(s*K>;g>|nQn- q+IU|nQn- q+dn|nQn- q+{|nQn- q+|nQn- q+=rGy=iG};Mt?mWC 3KOOyD<#*=(3Dh&!\ M}-4E-чHxV-чHkZIчHIчHIчH2IчH_S'@ )Ѹ*1@ )ѸSx1x )Ѹa:i:s:b:l:t:index %u out of range (%u max)Entry at index %u is not freeNo available table entriesNot enough space available on device for an aligned partitionNot enough space available on devicePartition %d added: %s %llu %llu[-a alignment] [-b blocknr] [-i index] [-l label][-s size] [-t type]Ac:i:L:b:No valid Protective MBR found/usr/mdec/gptmbr.binCan't allocate memory for bootpathCan't allocate memory for sectorThe bootcode in `%s' does not match the expected size %uError reading from `%s'Error reading bootcodeCannot update Protective MBRPartition %d marked as bootableNo bootable partitionbiosboot[-A] [-c bootcode] [-i index] [-L label] [-b startsec]AfPp:Device contains a MBRNo room for the PMBRError reading MBRCan't write PMBR[-AfP] [-p partitions]Device doesn't contain a GPTRecoverability not possibleError writing primary headerError writing backup headerError deleting PMBRdestroy[-r]PriSecBad CRC in GPT header at sector %juCannot read LBA table at sector %juBad CRC in GPT table at sector %ju%s GPT at sector %juGPT partition: type=%s, start=%ju, size=%juRead failedMBR not found at sector %juSuspicious PMBR at sector %juSuspicious MBR at sector %juMalformed MBR at sector %juMBR part: flag=%#x type=%d, start=%ju, size=%juCannot allocate `%s'Cannot openCannot statCannot get sector sizeSector size can't be 0Cannot get media sizeMedia size can't be 0Need 6 sectors, we have %jumediasize=%ju; sectorsize=%u; blocks=%juCan't update wedge informationYou need to run "dkctl %s makewedges" for the changes to take effect No primary GPT header; run create or recoverNo secondary GPT header; run recoverCorrupt maps, run recoverError writing crc mapError writing crc table Usage: %s%s %s %s%s %*s%s %s %s%s Already set to %jd new `%s'Bad number `%s'Number `%s' < 1Partition %d %sHeader %sEntry not specifiedAlignment (%#jx) must be a multiple of sector size (%#x)Size (%#jx) must be a multiple of sector size (%#x)Unrecognized attribute `%s'%s%10.10s %s Nothing to setIndex %u out of range (%u max)Entry at index %u is unusedPartition %d attributes updatedUnknown alignment/index/size option `%c'Can't parse uuidCan't copy string-a is already setUnknown find option `%c'%s: %juUnknown GPT header type %dError allocating %s GPT headerError adding %s GPT headerDevice already contains a GPT, destroy it firstNo room for the GPT headerNo room for the backup headerNo room for the GPT tableCan't allocate the primary GPT tableCan't add the primary GPT tableCan't add the secondary GPT tableLegacy BIOS boot partitionbootmeBootable partitionbootfailedPartition that marked bootonce failed to bootbootonceAttempt to boot this partition only oncenoblockioUEFI won't recognize file system for block I/OPartition required for platform to functionMedia SizeSector Size: %u Number of Sectors Header Information:- GPT Header not found- GPT Header Revision: %u.%u - First Data Sector- Last Data Sector- Media GUID: %s - Number of GPT Entries: %u label changedCan't label from `%s'ab:i:L:s:t:f:l:-a <-l label | -f file>[-b blocknr] [-i index] [-L label] [-s sectors] [-t uuid] <-l label | -f file>*unknown*Can't find mapmap entry doesn't fit media: new start + new size < start + size (%jx + %jx < %jx + %jx)partition(%ju,%ju) mirroredbogus map current=%s new=%sCan't create mapnegative size or alignmentCan't delete, next map is not foundCan't delete, next map is in useCan't coalesce %ju <= %juCan't expand map, no space after itCan't expand map, next map after it in useCan't expand map, not enough space in the next map after itmbr partitionprimary gpt headersecondary gpt headerprimary gpt tablesecondary gpt tablegpt partitionprotective mbr[-nrqv] [-m mediasize] [-s sectorsize] [-T timestamp]Usage: %s %s command device Usage: %s %s device command Commands: Can't parse timestamp `%s'm:nqrs:T:vUnknown command: %sCommand %s needs a device parameterUnknown FreeBSD partition (%d)*%u*Partition %u unknown type %s, using "Microsoft Basic Data"Error reading labelMBR partition without disklabelrawofs=%juDisklabel partition %u type %sAfp:sNo MBR in disk to convertMBR partition %u type %sunknown partition type (%d)Cant write PMBRmigrate[-Afs] [-p partitions]Adding %s GPT table failedWriting %s GPT table failedRecovered %s GPT table from %sWriting %s GPT header failedRecovered %s GPT header from %sDevice contains an MBRNo primary or secondary GPT headers, can't recoverNo primary or secondary GPT tables, can't recoverMedia size has changed, please use '%s resizedisk'Recreated PMBR (you may need to rerun 'gpt biosboot'ab:i:L:s:t:[-b blocknr] [-i index] [-L label] [-s sectors] [-t type]a:i:s:b:partition does not need resizingPartition %d resized: %llu %lluCould not find map entry corresponding to indexresize[-i index | -b blocknr] [-a alignment] [-s size]New size %ju too smallspecified number of sectors %jd is larger then the disk %jdNo valid PMBR foundNo primary GPT table; Run recoverError reading backup GPT information at %#jxNo secondary GPT header; Run recoverNo secondary GPT table; Run recoverDevice is already the specified sizeNot enough space at %llu for secondary GPT tableNot enough space for new secondary GPT tableError adding secondary GPT tableNo valid PMBR partition foundError writing PMBRresizediska:b:i:lN-a attribute [-i index] [-b startsec]-N [-i index] [-b startsec] (active)UnusedExtended Pri GPT headerSec GPT headerPri GPT tableSec GPT tableMBR part GPT part %lsUnknown %#x[partition not found?]%s: %lluType: %s (%s) NoneCould not find index %dDetails for index %d: Start %*s index contents %*llu%5d Type: %s TypeID: %s GUID: %s Size: Label: %s Attributes: gi:b:luaGPT not found, displaying data from MBR. %5dshow[-aglu] [-i index]type changedab:i:L:s:t:T:l-a -T newtype[-b blocknr] [-i index] [-L label] [-s sectors] [-t type] -T newtypea:b:i:l-a attribute -i index-a attribute -b startsec%08x-%04x-%04x-%02x%02x-%02x%02x%02x%02x%02x%02x%8x-%4hx-%4hx-%2hhx%2hhx-%2hhx%2hhx%2hhx%2hhx%2hhx%2hhx%s%18.18s %s Can't open `/dev/urandom'Can't read `/dev/urandom'EOF from /dev/urandomread too much: %zd > %zuappleapple-ufsbiosBIOS BootEFI Systemfbsd-legacyFreeBSD legacyfbsd-swapFreeBSD swapfbsd-ufsFreeBSD UFS/UFS2fbsd-vinumFreeBSD vinumfbsd-zfsFreeBSD ZFSlinux-dataLinux datalinux-raidLinux RAIDlinux-swapLinux swaplinux-lvmLinux LVMwindowsWindows basic datawindows-reservedWindows reservedNetBSD ccd componentNetBSD Cryptographic DiskNetBSD FFSv1/FFSv2NetBSD LFSNetBSD RAIDFrame componentNetBSD swapvmcoreVMware VMkernel core dumpvmfsvmreseredVMware reservedUUID changedo:sector_sizestart_headstart_sectorstart_cylinderend_headend_sectorend_cylinderlba_start_lowlba_start_highlba_size_lowlba_size_highproplib failurembr_arrayrevisionguidGPT_HDRgpt_arrayGPT_TBL[-o outfile]/dev/stdinFi:Device contains a GPTUnable to read/parse backup fileSector size does not match backupbackup is not revision 1.0%s: not able to convert to an UUIDBackup GPT doesn't fitnot enough memory to create a sector bufferCan't seek to beginningError writingCan't seek to endUnable to seek/write MBREntity index out of bounds %u > %u Unable to write primary GPTUnable to write secondary GPTUnable to write primary headerUnable to write secondary header[-F] [-i infile]in_addr_flagsin_statuscommit_addresssetethercapsdo_setethercaps.//setifnwkeysetifchansetifpowersavesetifssidsetifpowersavesleepsetifbssidsethidessidsetapbridgesetiffragsetifrts444440n&4Hp&4o&44p&0n&00` * p&Ho&4n&4Ln&4p&9 n&09 * p&1 n&1hn&5T1100D x1x1,setifprefixlensetifflagssetifmetricsetifmtusetifnetmasksetifdstormasksetifbroadaddrsetifcapssetifaddrclone_commandusageprintallstatusmaindo_setifpreferencedo_setifcaps9zip&PyiUUUp&-s&_UUp& = t&C t&-s&t<4 t&5Pt&=p&D;s&=!p&=s&=s&=p&=p&====> >>+>@7>C>O>W> `>0i>@r>{>>6 _>> >@Vyzinit_current_mediasetmediamodesetmediaoptsetmediasetmediainstA@8 L@8 `W@_@@W@_@A@8 V>\ media_statusmedia_constructor%@.@?`u&?.@?`u&.@.@ u&8@.@8@%@(u&7@.@M?Du&V.@Vu&paddr_match\@tNItNEN4GOH?tN>tNIsettunnelaARp&gAu&print_link_addressessetvlanifsetvlanyBpv&BABTv&~BB\SIOCAIFADDRSIOCDIFADDRSIOCGIFADDR%s: getsockSIOCGIFAFLAG_IN inet %s -> %s netmask %#x broadcast %sTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVE flags %s%s: getifnamenetmaskbroadcast%s: getifflags%s is not a broadcast interfaceunsupported interface flagsnetmask not supportedpre-%sethercap/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ether.cethercapsVLAN_MTUVLAN_HWTAGGINGJUMBO_MTUVLAN_HWFILTEREEE ec_capabilities=%s ec_enabled=%s sizeof(eccr) == prop_data_size(d)SIOCSETHERCAPvlan-hwfiltervlan-hwtaggingeeeNONEWEP40WEP104TKIPAES-CCMPAES-OCB%s: nwkey too longpersistpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY [ nwid network_id ] [ nwkey network_key | -nwkey ] [ list scan ] [ powersave | -powersave ] [ powersavesleep duration ] [ hidessid | -hidessid ] [ apbridge | -apbridge ] SIOCG80211NWID: wrong length of nwid (%d) ssid [hidden] [shown] apbridge -apbridge rts %d -rts frag %d -frag nwkey %d: powersave on (%dms sleep) chan %d bssid %s chan %dSIOCS80211BSSID/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/ieee80211.cSIOCS80211CHANNELSIOCG80211POWERpowersaveSIOCS80211POWER%s: SSID too longSIOCS80211NWIDpowersavesleep%s: BSSID too longmalformed BSSID: %sSIOCS80211hidessidsocket(PF_ROUTE,SOCK_RAW)read(PF_ROUTE)IEEE80211_IOC_FRAGTHRESHOLDIEEE80211_IOC_RTSTHRESHOLD RATES XRATES uc:8021X-UNSPEC8021X-PSK km:acm FHPARMS CFPARMS TIM IBSSPARMS CHALLENGE PWRCNSTR PWRCAP TPCREQ TPCREP SUPPCHAN CSA MEASREQ MEASREP QUIET IBSSDFS TPC CCKM ???unable to get scan results%-*.*s %-17.17s %4s %4s %-7s %3s %4s CAPSS:NRATE%-*.*s %s %3d %3dM %3d:%-3d %3d %-4.4s SSID%s<%.*s>%s%s%d DSPARMS<%u> COUNTRY%s<%c%c%c %u-%u,%u %u,%u ERP<0x%x> WPAaf_addr_commit != NULLpreferenceSIOCSIFADDRPREFsizeof(ifcr) == prop_data_size(d)SIOCSIFCAPiface-opt-familyoptional silent familyopt-clonemisciface-opt-family-onlycommand-rootoptional commandbroadcast address (address 3)destination/netmask (address 2)local address (address 1)no commandswait DADlist clonerstrailers-linkstr-descr-descriptionbroadcast addressip4csum-txip4csum-rxtcp4csum-txtcp4csum-rxudp4csum-txudp4csum-rxtcp6csum-txtcp6csum-rxudp6csum-txudp6csum-rxip4csumtcp4csumudp4csumtcp6csumudp6csumtso4tso6link0link1link2initmediaSIOCGIFMEDIA%s: prop_dictionary_set_bool%s: no link type?unknown %s media %s: %smediamodedata != NULL/usr/src/distrib/utils/x_ifconfig/../../../sbin/ifconfig/media.cunmediaoptsubtype [ media type ] [ mediaopt opts ] [ -mediaopt opts ] [ instance minst ] mediainstSIOCSIFMEDIA mode %s instance %d media: %s status: supported %s media: media mediaopt media keywordsinstanceanymedia-mediaoptno networkno carrierno ringinserted%u.%u%n%s: prefixlen_to_mask(%d, %ld)unknown keyword type %dtunsrctundst%s.%dsource and destination address families do not matchSIOCSLIFPHYADDR [ [ af ] tunnel src_addr dest_addr ] [ deletetunnel ] tunnel %s %s%s --> %s%s SIOCDIFPHYADDRdeletetunnelbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"address:%s: getifaddrs%s: ioctlSIOCGIFADDRPREF preference %d [ vlan n vlanif i ] [ -vlanif i ] valid only with vlan(4) interfacesvlantagSIOCSETVLAN vlan: %d parent: %s %s: getvlan-vlanifVLAN tagfatal signal: %scannot get kernel security level: %mcan't open %s: %mcan't get %s for controlling terminal: %mcannot change kernel security level from %d to %d: %m/dev/constty/dev/console/usr/bin:/bin:/usr/sbin:/sbin:/usr/pkg/bin:/usr/pkg/sbin:/usr/local/bin:/usr/local/sbincan't exec `%s' for single user: %mcan't fork single-user shell: %m, trying againwait for single-user shell failed: %m; restartingshell stopped, restartingsingle user shell terminated (%x), restarting./MAKEDEV/etc/MAKEDEVinitial setsid() failedsetlogin() failed/dev-MMMAKEDEV exit status %dUnable to run MAKEDEVinvalid major numberinvalid minor numbertoo many fields for formatusage: %s [-rR] [-F format] [-m mode] [-u user] [-g group] [ name [b | c] [major | driver] minor | name [b | c] major unit subunit | name [b | c] number | name p ] %s -l [driver] ... invalid format: %s%s: invalid group name%s: invalid user namelrRF:g:m:u: character major %d block major %dformat is meaningless for fifosnode type must be 'b', 'c' or 'p'.unknown driver: %sinvalid number: %s%s: uid/gid not changedinvalid unit numberinvalid subunit number386bsd4bsdbsdosfreebsdhpuxlinuxosf1solarissunossvr3svr4ultrix@LL\LL& L'@.:BMLL LL JMM%M;MLMaMtM# M@MMMM@MffsrMN NNNN%s,%sUsage: %s [-Aadfruvw] [-t type] %s [-dfruvw] special | node %s [-dfruvw] [-o options] [-t type] special node %s on %s type %.*s%sunknown flag%s %#x%smounted by %sfsid: 0x%x/0x%xreads: sync %llu async %llu, writes: sync %llu async %llugetargs, [%s: %s]realpath `%s'unionpuffs|%s on %s type %.*s: %s already mountedmount_puffsrumprump_%sexec:Cannot create pipeCannot open fd to mount programexec %s for %s: %sstatvfs %sOnly one -t option may be specified.Aadfo:rwt:uvfrom_mountUnknown file system %sUnknown special file or file system `%s'Unknown file system type for `%s':@WARNING: autoselecting nfs based on : or @ in the device name is deprecated! WARNING: This behaviour will be removed in a future release asynchronousautomountedextattrhiddennocoredumprelatimesoft dependenciessympermexported read-onlyNFS exportedexported to the worldanon uid mappingkerberos uid mappingnon-reserved portsWebNFS exportswith quotasroot file systembeing updatedreload filesystem dataforce unmount or readonly changeretrieve mount argumentsadosfilecorentfsudfefsnilfsstrdupJPTP?kLd/D_PJ LL KLJ@fPmPrP{PPPPP bnorripbgensbextattbnojolietbnocasetransbrrcaseinsusage: %s [-o options] special node getmntoptsegijo:r%s on %suserquotagroupquotardonlyextattgensmaplcasecasetransnrrrripjolietrrcaseinsWarning: realpath %s"%s" is a non-resolved or relative path.using "%s" instead.JPTP?kLd/D_PJ LL KL@RqJ@0@LLmount table fullincorrect super blockspecified device does not match mounted device%s on %s: %sreloadJPTP?kLd/D_PJ LL KL@RL0@qT& J@L\softdepJPTP?kLd/D_PJ LL KLJ@usage: mount_kernfs [-o options] /kern mount_point "%s" is a relative path.kernfs on %sJPTP?kLd/D_PJ LL KL@J@bshortnameblongnamebnowin95bgemdosfsbmntversionedbutf8bronlybwaitonfatbfatmirrorusage: %s [-9GlsU] [-g gid] [-M mask] [-m mask] [-o options] [-t gmtoff] [-u uid] special mountpath Gsl9Uu:g:m:M:o:t:uid=%d, gid=%d, mask=0%o, dirmask=0%o, gmtoff=%d, flags=%s unknown %s id: %sinvalid file mode: %sJPTP?kLd/D_PJ LL KLqJ@KU__X!_ '_@0_7_?_E_J_L N_ @ j]p]T_y]]] ]@bsoftbwsizebrsizebtimeobretransbmaxgrpsbintrbnoconnbnqnfsb nfsv3b kerbb dumbtimrb leasetermb readaheadbdeadthreshbresvportbrdirplusbreaddirsizebxlatecookiebnoacrecvrpcrpc_getportrpc_callsendrecv[-23bCcdilPpqsTUuX] [-a maxreadahead] [-D deadthresh]usage: %s %s %s %s %s %s rhost:path node [-w writesize] [-x retrans] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-g maxgroups] [-I readdirsize] [-L leaseterm]conflicting version optionsillegal -a value -- %sillegal -D value -- %sillegal -I value -- %swsizerdirsizeleasetermreadaheaddeadthreshtimeoretransillegal -R value -- %sillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %s23a:bcCdD:g:I:iKL:lm:o:PpqR:r:sTt:w:x:UuXgetnameinfo: %ssotype=%d, proto=%d, fhsize=%d, flags=%s, wsize=%d, rsize=%d, readdirsize=%d, timeo=%d, retrans=%d, maxgrouplist=%d, readahead=%d, leaseterm=%d, deadthresh=%d addr=%s, port=%s, addrlen=%d, conndumbtimernfsv3rdirplusmntudpresportnqnfssofttcpnfsv2maxgrpsUnsupported socket family %d%s: reject, astat=%d, errno=%d %s: error = %d %s: short write! (%zd < %zu)no : or @ speccan't get net id for host "%s": %sJPTP?kLd/D_PJ LL KLJ@LLusage: %s [-g group] [-m mode] [-n nodes] [-o options] [-s size] [-u user] tmpfs mount_point hw.physmem64can't get "hw.physmem64"failed to parse nodes `%s'ram/syntax error in ram fraction: ram/%s at %sram fraction must be a positive number: ram/%sram%syntax error in ram percentage: ram%%%s at %sram percentage must be a between 0 and 100 ram%%%sfailed to parse size `%s'g:m:n:o:s:u:cannot stat `%s'tmpfs on %sversion=%d, size_max=%llu, nodes_max=%llu, root_uid=%llu, root_uid=%s, root_gid=%llu, root_gid=%s, root_mode=%o Gknkkk lFlllllm'm;m[mmmmmn9nYnnnno,oQo%s: can't read disk label; disk type must be specified%s partition type is not `%s'WTWTbSS %s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device mount-point [disk-type]usage: %s [ fsoptions ] special-device%s where fsoptions are: NT:V:a:b:d:e:f:g:h:i:m:n:o:p:q:s:u:B:FGINO:S:T:V:Za:b:d:e:f:g:h:i:l:m:n:o:q:r:s:v:-mfsWARNING: -G may create file systems which cause kernel panics sector size `%s' is not a power of 2.unknown gname %sexpected files per directorynumber of inodesuse `space' or `time'.unknown optimization preference: invalid quota type %sbad mode `%s'unknown user %sApple UFS volume name cannot contain ':' or '/'Apple UFS volume name cannot be zero lengthin-filesystem quota is incompatible with -O0mount `%s' failedbase=%p, size=%ld can't open file %scan't fstat opened %s%s: open for read%s is a block device. use raw device%s: open for write%s: getmntinfo%s is mounted on %sno default sector size%s partition is unavailableUnable to determine file system sizesize %llu exceeds maximum file system size on `%s' of %llu sectorscan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing imageWarning: chosen fsize of %d is less than Apple UFS minimum of %dWarning: chosen bsize of %d is greater than Apple UFS maximum of %dbecause minfree is less thanWarning: changing optimization to space%s %s %d%%mfs:%d%s: mount: %sabnormal termination-B byteorder byte order (`be' or `le')-F create file system image in regular file-G make sanity calculations non-fatal (testing only!)-I do not check that the file system type is '4.2BSD'-N do not create file system, just print out parameters-O N filesystem format: 0 => 4.3BSD, 1 => FFSv1, 2 => FFSv2-S secsize sector size-T disktype disk type-V verbose output verbosity: 0 ==> none, 4 ==> max-Z pre-zero the image file-a maxcontig maximum contiguous blocks-b bsize block size-d maxbsize maximum extent size-e maxbpg maximum blocks per file in a cylinder group-f fsize frag size-g avgfilesize average file size-g groupname group name of mount point-h avgfpdir average files per directory-i density number of bytes per inode-m minfree minimum free space %-n inodes number of inodes (overrides -i density)-o optim optimization preference (`space' or `time')-q (user|group) enable specified quota-p perm permissions (in octal)-s fssize file system size (sectors)-u username user name of mount point-v volname Apple UFS volume namerdfs: read error for sector %lld: %s setblock bad fs_fragshift %d wtfs: write error for sector %lld: %s cg 0: bad magic numberfsinit: inode value out of range (%llu). isblock bad fs_fragshift %d internal error: can't find block in cyl 0clrblock bad fs_fragshift %d first cylinder group ran out of spaceillegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size %d is too large, maximum is %d block size (%d) cannot be smaller than fragment size (%d) Maxcontig raised to %d fragment size %d is too small, minimum with block size %d is %d ilog2: %d is not a power of 2Too many fragments (0x%llx) for a FFSv1 filesystem Filesystem size %lld < minimum size of %d CGSIZE miscalculated %d > %d %s: %.1fMB (%lld sectors) block size %d, fragment size %d using %d cylinder groups of %.2fMB, %d blks, %d inodes. Cannot allocate I/O bufferpreposterous size %lld super-block backups (for fsck_ffs -b #) at: Too many cylinder groups to fit summary information into first cylinder groupPanic: cylinder group too big%s%*llu,Error making filesystemNo space for superblock -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file %s: can't read disk label%s partition type is not `%s' (or use -I)ilog2rdfswtfsSSSWTWTbiputallocinit_resizeinofsinitusage: %s [ fsoptions ] special-device Bad inode size %d (only 128 and 256 supported)Volume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:s:v:%s: %u is not a power of 2%s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode%s: no free inode %llu in block group %u%s: inode %llu already in use%s: inode value out of range (%llu)%s: inconsistent bitmapblock size must be a power of 2, not %ufragment size must be a power of 2, not %ufragment size %u is too small, minimum is %ublock size %u is too small, minimum is %ublock size %u is too large, maximum is %ublock size (%u) can't be different from fragment size (%u)GOOD_OLD_REV file system format doesn't support %d byte inodeFilesystem size %lld < minimum size of %lldFailed to generate uuidVolume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Preposterous size %lldsuper-block backups (for fsck_ext2fs -b #) at:%s: large_file rocompat feature is required to enable resize feature for this filesystem%s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir usage: %s [-aCDdfLnoPQqRrv] [-c count] [-g gateway] [-h host] [-I addr] [-i interval] [-l preload] [-p pattern] [-s size] [-T ttl] [-t tos] [-w maxwait] host Cannot resolve "%s" (%s)%s only supported with IP Vr HL TOS Len ID Flg off TTL Pro cks Src Dst %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %15s TCP: from port %u, to port %u UDP: from port %u, to port %u ID=%u icmp_seq=%u for icmp_seq=%ublocksignals: sigprocmask%s (%s)0.0.0.0 ----%s PING Statistics---- %d packets transmitted, %d packets received, +%d duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/stddev = %.*f/%.*f/%.*f/%.*f ms %.1f packets/sec sent, %.1f packets/sec received Can't turn off special IP headerfailed to clear cached routeCan't set special IP headersendtowrote %s %d chars, ret=%d%d bytes from %s: %d bytes from %s: icmp_seq=%u DUP! ttl=%d time=%.*f msCannot create socketCannot shutdown for readsetuidBad/invalid number of packets: %sBad/invalid interval: %sTiming interval %g too largeBad/invalid preload value: %sOnly one of -P and -p allowedBad/invalid packet size: %spacket size is too largebad tos value: %sttl out of range: %s-gBad/invalid maxwait time: %sac:CdDfg:h:i:I:l:Lnop:PqQrRs:t:T:vw:Must be superuser to use -fMust be superuser to use < 1 sec ping intervalMust be superuser to use -lPacket interval must be at least 1 nsSorry, no audible output for flood pingsCan't allocate %d bytes"-p %s": patterns must be specified with 1-32 hex digits %2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xCan't turn on socket debuggingSO_DONTROUTECan't disable multicast loopbackCan't set multicast time-to-liveCan't set multicast source interfaceCan't set source interface/addressPING %s (%s): %d data bytes Cannot set the receive buffer sizeenablesignals: sigprocmaskpollrecvfrompacket too short (%d bytes) from %s remote host does not support record route remote host does not support source route wrong total length %d instead of %d[*** sequence gap of %u packets from %u ... %u ***] wrong data byte #%d should have been %#x but was %#xDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set. Next MTU=%dSource Route FailedUnreachable unknown netUnreachable unknown hostUnreachable host isolatedNet prohibited accessHost prohibited accessBad TOS for netBad TOS for hostCommunication prohibitedHost precedence violationPrecedence cutoffBad Destination Unreachable Code: %dSource QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect--Bad Code: %d New router addr: %sEcho Request: ID=%d seq=%dRouter Discovery AdvertRouter Discovery SolicitTime To Live exceededFrag reassembly time exceededTime exceeded, Bad Code: %dParameter problem: pointer = 0x%02xTimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask ReplyBad ICMP type: %d LSRR: (same route) RR: NOP unknown option 0x%xusage: %s [-dln%sqvxz] [-- ] (can't restart init): poweroffdlnpqvxzhalted by %spowered off by %srebooted by %s: %srebooted by %sSIGTSTP initSIGTERM all processesSIGKILL all processesWARNING: some process(es) wouldn't diereboot(){{{{ {{{{zusage: %s -i [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -R [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -r [-cdvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] %s -t [-cdhvy] [-b bsize] [-D algorithm] [-f file] [-s fileno] [file ...] %s -x [-cdhmvyN] [-b bsize] [-D algorithm] [-f file] [-M mtreefile] [-s fileno] [file ...] option requires an argument -- %cillegal blocksize -- %sblock size must be greater than 0unknown digest algorithm: %s%c and %c options are mutually exclusivecan't open %sillegal dump number -- %sdump number must be greater than 0b:cD:df:himM:NRrs:tuvxynone of i, R, r, t or x options specifiedBegin incremental restore ./restoresymtableCalculate node updates. Begin level 0 restore Calculate extraction list. Verify the directory structure command lines cannot be continued missing %c Warning: undefined file type %d %s > %s: %s: no filename match. glob() aborted. unknown error! %s: not a directory %s: not on extraction list ls [arg] - list directory Available commands are: %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s directory is used If no `arg' is supplied, the current Debug - turn on debugging help or `?' - print this list (useful with ``ls'') verbose - toggle verbose flag what - list dump header information quit or xit - immediately exit program setmodes - set modes of requested directories extract - extract requested files list of files to be extracted delete [arg] - delete `arg' from add [arg] - add `arg' to list of pwd - print current directory cd arg - change directory ls: out of memory directory reopen failed %s%s: name exceeds %d char / verbose mode off verbose mode on setmodeswhatDebugdebugging mode off debugging mode on %s: unknown command; type ? for help restore interrupted, continue|NIL|ONTAPE|INOFND|NAMEFND|MODECHGdir %10llu %s %s: not on the tape ./%lluMark entries to be removed. Delete whiteouts %s: REMOVE corrupted symbol table name/inode conflict, mktempname %s [%s] %s: %s deleted hard link %s to directory %s [%s] %s: %s|LINK cannot KEEP and change modesNODE and LEAF links to same inode[%s] %s: Extraneous name %s: (inode %llu) not found on tape [%s] %s: inconsistent state [%s] %s: impossible state Find unreferenced names. %s: remove unreferenced name unreferenced with flagsRemove old nodes (directories). cannot remove, non-emptyContinue extraction of new leaves Extract new leaves. %llu: bad first %s: not found on tape expected next file %llu, got %llu unknown file on tape unexpected file on tapeExtract requested files Add whiteouts Add links Check the symbol table. incomplete operationsWarning: missing name %s type should be LEAFmissing inumber %llu Mangled directory: reclen not multiple of 4 reclen less than UFS_DIRSIZ (%d < %lu) bad seek pointer to rst_seekdir %d Extract directories from tape %s/rstdir%d%s/rstdir%d-XXXXXXcannot mkstemp temporary file %scannot open temporary file %s%s/rstmode%d%s/rstmode%d-XXXXXXopendirfile: %s Root directory is not on tape no memory directory table error reading directory corrupted directory: bad reclen %d corrupted directory: bad inum %d %s/Warning: `.' missing from directory %s Warning: `..' missing from directory %s %s%s: name exceeds %lu char Set directory mode, owner, and times. modefile not defined directory mode, owner, and times not set fopen: %s cannot open mode file %s cannot find directory inode %llu error setting directory modes Cannot find directory inode %llu named %s write error extracting inode %llu, name %s read: %s cannot find entry in parent listaddino: out of range %llu duplicate inumdeleteino: out of range %llu deleteino: %llu not found %s is not a directory %s: pathname too long bad name no space for string table no memory to extend symbol table bad name to addentry %s link to non-existent name duplicate entry not marked REMOVEDfreeing referenced directoryfreeing non-empty directorylookupino failedlink not foundcannot move ROOTCheckpointing the restore cannot create save file %s for symbol table fwrite: %s output error to file %s writing symbol table Initialize symbol table. no memory for entry table cannot open symbol table file %s stat: %s cannot stat symbol table file %s cannot allocate space for symbol table cannot read symbol table file %s Incremental tape too low Incremental tape too high initsymtable called from command %c Checksum error %o, inode %llu file %s unallocated block in symbolic link %s symbolic link name: %s->%s%s; too long %d Cannot have multiple dumps on pipe input ioctl MTFSF: %s seek error extracting inode %llu, name %s lseek: %s End-of-input encountered while extractingWarning: %s %s write error extracting inode %llu, name %s write: %s Cannot allocate space for tape buffer cannot open %s: %s the epoch [unknown]#Dump date: %s#Dumped from: %s#Level %d dump of %s on %s:%s #Label: %s /set uname=root gname=wheel error writing to mtree fileChanging volumes on pipe input? Unless you know which volume yourYou have not read any tapes yet. towards the first. with the last volume and work file(s) are on you should start (Use 1 for the first volume/tape, etc.) You have read volumesSpecify next volume #: Volume numbers are positive numerics Mount tape volume %d Enter ``none'' if there are no more tapes otherwise enter tape name (default: %s) Cannot open %s header read failed at %d blocks tape is not dump tape Volume mismatch: expecting %d, tape header claims it is %d Wrong dump date got: %s wanted: %sread %ld recs, tape starts with %ld Skipping %d duplicate record%s. active file into volume 1 mid-media short read error. partial block read: %d should be %d Tape read error while trying to set up tape trying to resynchronize restoring %s skipping over inode %llu continuation failed: %s End-of-tape encountered Note: Doing Byte swapping gethead: unknown inode type %d Volume header (%s inode format) begins with record %lldDumped inodes map headerUsed inodes map headerFile header, ino %lluFile continuation header, ino %lluEnd of tape header; predicted %ld blocks, got %ld blocksunexpected tape header unknown tape header type %d resync restore, skipped %ld blocks ran off end of tape not at beginning of a file Missing address (header) block for %s at %d blocks %s: unknown file mode 0%o skipped socket %s unextracted directory %s extract file %s %s: zero length symbolic link (ignored) extract special file %s %s: cannot create special file: %s extract fifo %s %s: cannot create fifo: %s fifo%s: cannot create file: %s %s (%s) = %s no memory for %s %s: inconsistent map size %s: map size changed Verify tape and initialize maps tape read error: %s is not a multiple of dump block sizeTape block size (%ld) %s (%ld) Tape block size is %d Tape is not a dump tape Converting to new file system format. cannot stat .: %s bad block size %d Tape is not volume 1 of the dump no header after volume mark! Cannot find file removal list MD5SHA1RMD160warning: cannot rename %s to %s: %s rename %s to %s warning: cannot create whiteout %s: %s Create whiteout %s |REMOVED|TMPNAME|EXTRACT|NEW|KEEP|EXISTED%s is not on the tape dump coresymbolichardwarning: cannot create symbolic link %s->%s: %s warning: cannot create hard link %s->%s: %s linkit: unknown type %d Create %s link %s->%s bad entry: %s parent name %s sibling name: %s next entry name: %s next link name: %s next hashchain name: %s entry type: %s inode number: %ld flags: %s not on ino listRSTTMP%s%ld%llumktempname: called with TMPNAMEnewnode: not a nodewarning: %s: %s Make node %s removenode: not a noderemovenode: non-empty directoryRemove node %s removeleaf: not a leafRemove leaf %s delwhiteout: not a leafwarning: cannot delete whiteout %s: %s Delete whiteout %s %s type=%s uid=%d gid=%d mode=%#4.4o flags=nodump%suchg%suappnd%sopaque%sarch%sschg%ssappndLost connection to remote host.Protocol to remote tape server botched. (rmtgets got "%s"). Protocol to remote tape server botched (code "%s"). shell/tcp: unknown servicewho are you?invalid user name: %s/etc/rmtO%s %d C R%d W%d L%d %d I%d %d DSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD TAGTENTATIVEDUPLICATEDDETACHEDTRYTENTATIVEANYCASTTENTATIVEDUPLICATEDDETACHEDDEPRECATEDNODADAUTOCONFTEMPORARYδ,Uǵ3eն-UPBROADCASTDEBUGLOOPBACKPOINTOPOINTRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CONNECTED XRESOLVE LLINFO STATIC BLACKHOLECLONEDPROTO2PROTO1SRCANNOUNCELOCALBROADCASTUPDATINGMTUHOPCOUNTEXPIRERECVPIPESENDPIPESSTHRESHRTTRTTVARdfLnqSsTtvUGHRBD M@dmCLS1@2plb0123456789abcdefatalkhopcountinet6lockrestnostaticproto1proto2recvpiperttrttvarsasendpipessthreshx25xnsflushallnocloningnoconnectednoblackholenorejectmpls%s: inet %s; %s: link %s; %s: (%d) %s; not in tableentry in userouting table overflowprefixlen is not supported with af %d%s: bad value sockaddrs: routing message version %d not understood #%d: len %d, if# %d, %s, flags: pid %d, metric %d, addrflags: if# %d, what: re-associatedisassociatescan completejoinmichaelreplay (truncated) mac %02x:%02x:%02x:%02x:%02x:%02x src %02x:%02x:%02x:%02x:%02x:%02x dst %02x:%02x:%02x:%02x:%02x:%02x cipher %u keyix %u key rsc %#llx frame rsc %#llxarrivalpid %d, seq %d, errno %d, flags: locks: inits: route-sysctl-estimateactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socket, got %d for rlen%-20.20s writing to routing socket: %sbotched keyword: %sUsage: %s [-%s] cmd [[-] args] Internal ErrorCannot allocate memoryassuming route to ifold usage of trailing 0assuming route via gatewayold usage of trailing digitmissing destination specificationmissing gateway specification-host and -net conflictsoup->so_dstsoup->so_gatesoup->so_masksoup->so_genmasksoup->so_ifpsoup->so_ifa: gateway %sRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics, Flags or GatewayRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_OOIFINFO: iface status change (pre-1.5)RTM_OIFINFO: iface status change (pre-64bit time)RTM_IFANNOUNCE: iface arrival/departureRTM_IEEE80211: IEEE80211 wireless eventRTM_IFINFO: iface status changeRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_CHGADDR: address being changed on ifacelink#%dDestination%-*.*s %-*.*s %-6.6s FlagsInternetEncapAppleTalk Protocol Family %d: %-6.6s %u.%u.%u.%u/%d(%d) %saf %d: %ssysctl of routing tableRouting tables%6s %8s unspecPFPF0* XXX,,x<<Usage: %s [-Ddfhknprvxz] [-b bootstr] time [message ... | -] illegal time formatFINAL /usr/bin/wall%s -n%s: Can't find `%s' (%m)*** %sSystem shutdown message from %s@%s *** System going down at %5.5s System going down in %ld minute%s System going down in 30 seconds System going down IMMEDIATELY /etc/nologin NO LOGINS: System going down at /sbin/reboot/sbin/halt%s: Not super-userb:DdfhknprvxzIncompatible options -f and -nIncompatible options -%s and -rnowTZtime is already pastShutdown at %.24s. Shutdown NOW!shutdown: forkshutdown: [pid %d] %s by %s: %s System shutdown time has arrived but you'll have to do it yourself /fastbootfastboot file for fsck About to run shutdown hooks... . /etc/rc.shutdown Done running shutdown hooks. -v-x-z-dCan't exec `%s' (%m)Can't exec `%s'usage: %s [-t ldisc] [-hHlmn] [-s baudrate] ttyname hHlmns:t:TIOCSDTRTIOCSLINEDcouldn't detachslipbitmask_printbitmask_scanx^:$2DQWtfPth<<T0<O[<hz4RZRRR #P4S^ej& binu%07x%07zu bytes %s,%zu%s 1%s 2[-dneq] [-x[x]|-r] variable ...usage: %s %s %s %s %s %s %s %s %s %s %s %s [-dne] [-q] -f file[-ne] -M[-dne] -A[-dne] -a[-ne] [-q] -w variable=value ...%s#%zu: %s: the value is not available (%s) bad size %zu for kern.drivers%s[%d %d %s]%s level name '%s' in '%s' is invalid Must specify -w to set descriptions %s: CTL_DESCRIBE failed: %s %s: description not set \x%2.2x0x%0*x0x%0*llx%s: '%s' is not a valid limit %s: failed query %s: '%s' is an invalid mode %04o (%s)%s: this type is unknown to this program ...(%zu more bytes)Invalid port: %sPort out of range: %s%s: !returned size wrong!%.2f %.2f %.2f hw.ncpu%d = %lluuser = %llu, nice = %llu, sys = %llu, intr = %llu, idle = %llu 0x%llx %lld.%9.9ld %s: use '%s' to view this information %s: use 'netstat' to view this information %s: missing 'options DEBUG' from kernel? %s: missing 'options DDB' from kernel? %s: no vendor extensions installed tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d regcomp: %s: %sregexec: %s: %s%s (%s): CTLTYPE_%s, alias %d, children %d/%d, size %zuREADONLYREADWRITEANYWRITEPRIVATEPERMANENTOWNDATAIMMEDIATEHEXANYNUMBERHIDDEN, flags 0x%x<%s>, func=%p, ver=%d(no description)Cannot print `%s': %s %s: node contains no data %s: no children %s: !malloc failed! symbolstructMust specify -w to create nodes %s: already have %s for new node %s: missing value %s: '%s' is not a valid address quad%s: '%s' is not a valid type %s: '%s' is not a valid size %s: '%s' is not a valid mib number %s: '%c' is not a valid flag %s: unrecognized keyword '%s' %s: cannot specify both value and address %s: '%s' is not a valid integer %s: '%s' is not a valid bool %s: ignoring size=%zu for string node, too small for given value %s: '%s' is not a valid quad %s: struct not initializable %s: need a size or a starting value %s: cannot make an immediate %s %s: nodes do not have data %s: wrong size for type %s: struct must have size %s: CTL_CREATE failed: %s %s(%s): (created) Must specify -w to destroy nodes %s: CTL_DESTROY failed: %s %s(%s): (destroyed) describeunable to parse '%s' Must specify -w to set variables Cannot write `%s': %s %s: not a number %s: string too long Aabdef:Mnqrwxmalloc regexSTRINGQUADSTRUCTBOOLsecondthirdfourthfifthsixthseventheighthninthtentheleventhtwelfth = /kern/clockrate/kern/evcntvmstat -e/kern/vnodepstat/kern/proc(2|_args)?/kern/file2?/kern/ntptimentpdc -c kerninfo/kern/msgbufdmesg/kern/boottime/kern/consdev/kern/cp_time(/[0-9]+)?/kern/sysvipc_infoipcs/kern/cp_id(/[0-9]+)?/kern/coredump/setid/mode/kern/drivers/kern/intr/listintrctl/kern/intr/affinity/kern/intr/intr/kern/intr/nointr/vm/vmmetervmstat' or 'systat/vm/loadavg/vm/uvmexp2?/vfs/nfs/nfsstatsnfsstat/net/inet6?/tcp6?/identidentd/net/inet6/icmp6/nd6_[dp]rlistndp/net/inet6/ip6/addctlpolicyip6addrctl/net/key/dumps[ap]setkey/net/[^/]+/[^/]+/pcblistnetstat' or 'sockstat/net/(inet|inet6)/[^/]+/statsnetstat/net/inet/(ipip|esp|ah|ipcomp)/.*_stats/net/inet/ipsec/ipsecstats/net/bpf/(stats|peers)/net/inet.*/tcp.*/deb.*trpt/net/inet.*/ip.*/anonportalgo/reserve/net/ns/spp/deb.*trsp/hw/diskstatsiostat/machdep/consdev/proc/[^/]+/rlimit/[^/]+/[^/]+/net/[^/]+/debug/ddb/vendorhw.disknamesusage: %s -A [-f|-o] [-n] [-p priority] [-t blk|noblk|auto] %s -a [-p priority] path %s -q %s -c -p priority path %s -D dumpdev|none %s -d path %s -l | -s [-k|-m|-g|-h] %s -U [-n] [-t blk|noblk|auto] %s -z could not set dump device to %s%s: setting dump device to %s WARNING: %s is readable by the worldWARNING: %s is writable by the world%s: adding %s as swap device at priority 0 %s: removing %s as swap device %s%s%cswpriority=nfsmntpt=empty mountpoint/sbin/mount_nfs%s: mount failed/sbin/umountnoblk%s: adding %s as swap device at priority %d %s: failed to add %s as swap device %s: failed to remove %s as swap device %s: umount failedswaponusage: %s -a [-t blk|noblk] %s ... ADUacdfghklmnop:qst:zcould not get dump deviceno dump device setdump device is major %llu minor %llu %s: there are swap or dump devices defined in /etc/fstab %s: no swap or dump devices in /etc/fstab KBytesMBytesGBytesno swap devices configuredSWAP_STATSSWAP_STATS different to SWAP_NSWAP (%d != %d)Device%-*s %*s %8s %8s %8s %s PriorityCapacityAvailUsed%-*s %*ld %8ld %8ld %5.0f%% %d %-*s %*s %8s %8s %5.0f%% %d %s/%s swap space %ld/%ld %s swap space total: %s allocated, %s used, %s available. total: %ld %s allocated, %ld %s used, %ld %s available Total%-*s %*s %8s %8s %5.0f%% %-*s %*ld %8ld %8ld %5.0f%% Usage: %s [-fR] special | node %s: not currently mountedumount_%s%s: execvpfRfetch_url0Rsendrequestrecvrequest***************************************************************************************************************************************************************************************************************************************TYPE %s %sTYPE %s%s: unknown mode. Continue with%s %s [anpqy?]? %s; %s aborted Prompting off for duration of %s. Interactive mode: off. confirmation options: a answer `yes' for the duration of %s n answer `no' for this file p turn off `prompt' mode q stop the current %s y answer `yes' for this file ? this help list nmap: unbalanced brackets. Using %s mode to transfer files. changetype: unknown type %dbinarytenexWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. STORAPPESTOUlocal-fileremote-filelocal-filesGlob pattern `%s' not foundRestart is not supported by the remote server. RETRr+remote-filesmregetSkipping non-relative filename `%s' Can't open source file %s 20210106NetBSD-ftpVersion: %s %s %s %s. Bell modeEditing support not compiled in; ignoring command. Packet tracingmark: bad bytecount value `%s'. Hash mark printing %s (%d bytes/hash mark)Verbose modeUse of PORT/LPRT cmdsProgress barInteractive mode(none)Disabling gate-ftp mode - no gate-ftp server defined. Gate ftp: %s, server %s, port %s. GlobbingPreserve modification times%s: bad debugging value. Debugging %s (ftp_debug=%d). remote-directoryCWD command not recognized, trying XCWD. XCWD %sCan't chdir `%s'Local directory now: %s Unable to determine local directory DELE %sfrom-nameto-nameRNFR %sRNTO %sMLSDNLSTMLSD is not supported by the remote server. nlistpageroutput to local-file:mlsCan't execute `%s'Can't fork a subshell; try again laterusernameUSER %sPassword: PASS %sAccount: ACCT %sLogin failed. Unable to determine remote directory Remote directory: %s Local directory: %s directory-nameMKD command not recognized, trying XMKD. XMKD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendarguments to SITE commandSITE SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITAccount:?Ambiguous command. ?Invalid command. ?Invalid proxy command. Not connected. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutPassive mode: %s; fallback to active mode: %s. EPSV/EPRT on IPv4EPSV/EPRT on IPv6Store uniqueReceive uniqueGet transfer rate throttle: %s; maximum: %d; increment %d. Put transfer rate throttle: %s; maximum: %d; increment %d. CDUPCDUP command not recognized, trying XCUP. XCUPrestart: Invalid offset `%s' No restart point defined. Restarting at %lld for next get, put or append SYSTLimit of 16 macros have already been defined. macro nameEnter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. %s %lld %s %sSTATSTAT %sLocal file "%s" is newer than remote file "%s". sndbufxferbuf%s: size must be positive. Socket buffer sizes: send %d, receive %d. No such option `%s'. Setting `%s' to `%s'. %-*s %s Unsetting `%s'. FEAT is not supported by the remote server. FEATMLST is not supported by the remote server. MLSTMLST %sOPTS is not supported by the remote server. OPTS %sOPTS %s %sebcdicanonpassftp_proxyhttp_proxyhttps_proxyno_proxyrpromptaccountbyecdupdisconnectepsvepsv4epsv6featuresfgetidlelcdlpagelpwdmacdefmdeletemgetmlstmodtimemputmsendnewernmapntranspassivepdirpmlsdquoterecvremoptsrenameresetrestartrhelprstatusruniquesendportsitesuniquethrottle'%s' macro not found. %s: HTTP fetch aborted. %s: HTTP fetch timeout. Host: %sHost: [%s]parse_url: invoked with NULL argument!http://ftp://file://Invalid %s `%s'Unknown port `%s' in %s `%s'Receiving HTTP reply: %sInvalid URL `%s';type=a;type=i;type=dDirectory listing via a URL is not supportedInvalid suffix `%s' in URL `%s'*?[]{}Can't connect or login to host `%s:%s'fetch_ftp: unknown transfer type %d ftp: The `CWD ' command (without a directory), which is required by RFC 3986 to support the empty directory in the URL pathname (`//'), conflicts with the server's conformance to RFC 959. Try the same URL without the `//' in the URL pathname. Pragma: no-cache Cache-Control: no-cache (localhostNo support for non local file URL `%s'Invalid URL (no file after host) `%s'No file after directory (you must specify an output file) `%s'copiedCan't seek to restart `%s'Copying %s (restarting at %lld)retrieved ,Can't restart via proxy URL `%s'Scoped address notation `%s' disallowed via web proxyproxy URLMalformed proxy URL `%s'Can't LOOKUP `%s:%s': %sTrying %s:%s ... Can't create socket for connection to `%s:%s'Can't connect to `%s:%s'Requesting %s %svia %s:%uGET %s HTTP/1.0 GET %s HTTP/1.1 Accept: */* Connection: close Range: bytes=%lld- restarting at %lldFTPUSERAGENTUser-Agent: %s User-Agent: %s/%s %swith authorization%swith proxy authorizationProxy-Authorization: %s Writing HTTP requestalready done Size of `%s' differs from save file `%s'rcvbuf_size > 0/usr/src/usr.bin/ftp/fetch.cUnexpected EOF reading chunk-sizeInvalid chunk-sizeChunk-size `%.*s'Unexpected data following chunk-sizeWriting `%s'Unexpected EOF reading chunk CRLFUnexpected data following chunkReading fileCan't change modification time to %sImproper response from `%s:%s'Unsupported URL scheme `%.*s'Content-Length:Content-Range:Received unexpected Content-Range headerLast-Modified:Location:Transfer-Encoding:Bogus transfer encoding `binary' (fetching anyway)chunkedUnsupported transfer encoding `%s'Proxy-Authenticate:BasicWWW-Authenticate:Not expecting partial content headerNo redirection Location provided by serverToo many redirections requestedRedirected via %s Redirected to %s Error retrieving file `%s'Unknown error retrieving file remote abort aborted; closing connection. receive sendabortxfer: unknown direction `%s' aborted. Waiting for remote to finish abort. 421 Service not available, %s. No control connection for commandCan't lookup `%s:%s': %sCan't determine my address of connection to `%s:%s'Can't fdopen socketConnected to %s. Can't create socket for data connectionEPSVwrong server: return code must be 229 PASVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! parse error! Can't set SO_REUSEADDR on data connectionCan't bind for data connectionCan't determine my address of data connectionCan't listen to data connectionEPRT |%u|%s|%s|PORT %d,%d,%d,%d,%d,%d%c%c%c%d%cPoll timeout waiting before acceptCan't poll waiting before acceptCan't accept data connectionCan't access `%s'runique: can't find unique file name. Lost control connection for abortCan't send abort message%cABOR proxy server does not support third party transfers. No primary connection. PORT %sREST %lldlocal: %s remote: %s Error aborting proxy commandlocal: %s %s: not a plain file. sndbuf_size > 0/usr/src/usr.bin/ftp/ftp.cReading `%s'Writing to networkCan't chmod `%s'Reading from networkWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sUsage error Error resetting connectionremote server timed out. Connection closeduser interrupt. Connection closedremote server has closed connectionusage: %s [-46AadefginpRtVv] [-N netrc] [-o outfile] [-P port] [-q quittime] [-r retry] [-s srcaddr] [-T dir,max[,inc]] [-x xferbufsize] [[user@]host [port]] [host:path[/]] [file:///file] [ftp://[user[:pass]@]host[:port]/path[/]] [http://[user[:pass]@]host[:port]/path] [...] %s -u URL file [...] ftp> prompt: no such option `prompt'rprompt: no such option `rprompt'Proxy c%sommands may be abbreviated. Commands are: ?Ambiguous %s command `%s' ?Invalid %s command `%s' Sorry, input line is too long. httpFTPSERVERPORTftpgateNETRC$NETRC `%s': %sFTPMODEUnknown $FTPMODE `%s'; using defaultspftpFTPSERVERNeither $FTPSERVER nor GATE_SERVER is defined; disabling gate-ftpdumbINET6 support is not available; ignoring -6Bad quit value: %sBad retry value: %sBad throttle value `%s'Bad xferbuf value: %s46AadefginN:o:pP:q:r:Rs:tT:u:vVx:Can't lookup `%s': %s/.netrc%s/.netrc: %sanonymousFTPANONPASSPAGERFTPPROMPTFTPRPROMPTRetrying in %d seconds... getoptionvalue: invoked with NULL namegetoptionvalue: invoked with unknown option `%s'%lld byte%s %s in %d day%s %2d:%02d:%02d (%lld.%02d %.2sB/s) ETA: %02d:%02d (stalled) %s: transfer aborted because stalled for %lu sec. %3d%% |%.*s%*s| %5lld %-3s %3lld.%02d %.2sB/s --:-- ETA - stalled -%02d:%02d ETAKiBMiBGiBTiBPiBEiBToken in .netrc too longCan't read `%s'Error: .netrc file is readable by othersRemove password or make file unreadable by othersRemove account or make file unreadable by othersMissing macdef name argument. Macro definition missing null line terminator. Unknown .netrc keyword `%s'4K macro buffer exceeded. machineMDTMREST STREAMTVFS Remote system type is %.*s. unix215 TOPS20Remember to set tenex mode when transferring binary files from this machine. ftpXXXXXXXXXXUnable to create temporary file `%s'Can't find list of remote filesSIZE is not supported by remote server. SIZE %sMDTM is not supported by remote server. MDTM %s191Y2K warning! Incorrect time-val `%s' received from server. Converted to `%s' Can't parse time `%s'. %Y%m%d%H%M%S%a, %d %b %Y %H:%M:%S %z Can't convert RFC 2822 time: buffer too small%a, %d %b %Y %H:%M:%S GMT%a, %d-%b-%y %H:%M:%S GMT%a, %b %d %H:%M:%S %YUnable to determine real path of `%s'crankrate invoked with unknown signal: %dUnable to determine rcvbuf sizeUnable to determine sndbuf sizeUnable to set sndbuf size %dUnable to set rcvbuf size %d EOF receivedError encounteredInput line is too longSorry, arguments too long. (%s) operation%s; %s aborted. Can't bind to `%s'Can't %s socket flags for connect to `%s:%s'Can't set socket non-blocking for connect to `%s:%s'Unable to allocate %ld bytes of memoryUnable to allocate memory for stringlistUnable to add `%s' to stringlistftp_strdup: called with NULL argumentUnable to allocate memory for string copyName (%s:%s): Name (%s): Login failed$initAlready connected to %s, use close first. main: gateserver not definedConnecting via pass-through server %s non-printstream disconnecting...unknown ACU typecan't open phone number fileunrecognizable host name call abortedhayes timeout error (%s) [sh] ! can't execlcan't forkcan't create %s [cd] %s: bad directory %s [EOT] %d %s%c %d write error lines transferred in Local command? can't establish pipe can't fork! List command for remote system? can't execl! chars transferred in timed out at eol can't find `%s' away for [set] ~{[*?$`'"\echo %s"Echo" failed "%s": No match Buffer overflow expanding "%s" Local file name? %s: cannot create [take] usage: from [to] cat %s;echo %s: cannot open [put] usage: from [to] cat>%s stty -echo;cat>%s;stty echo minutehourreceive file from remote hostsend file to remote hosttake file from remote UNIXput file to remote UNIXpipe remote filepipe local command to remote hostconnect program to remote hostchange directoryexit from tipsuspend tip (local+remote)suspend tip (local only)set variableget this summarysend breakUsage: cu [options] [phone-number|"dir"] Use cu --help for help BSD tip/cu Usage: cu [options] [phone-number|"dir"] -E,--escape char: Use this escape character -F,--flow {hard,soft,none}: Use RTS/CTS, ^S/^Q, no flow control -f: Use no flow control --nostop: Do not use software flow control -a, -p,--port port: Use this port as ACU/Dialer -c,--phone number: Call this number -h,--halfduplex: Echo characters locally (use "half duplex") -e: Use even parity -o: Use odd parity -P,--parity {even,odd,none}: use even, odd, no parity -l,--line line: Use this device (ttyXX) -n: Disable escape character processing -s,--speed,--baud speed,-#: Use this speed -t: Connect via hard-wired connection only one escape character allowedbad flow settingevenbad parity settingmore than one line specifiedmore than one parity specifiedE:F:P:a:p:c:l:ns:hefot0123456789more than one phone number specifiedcu%dall ports busylink downunsupported speed %ldConnect failedescapephonehalfduplexnostopHOSTno host specifiedREMOTE/etc/remoteunknown host %scan't open host description filepossible reference loop in host description filedu%s: missing device spec%s: missing phone numbervbprdldvcmpndiusage: %s [-v] [-speed] system-name %s [-v] [-speed] phone-number n r t fEb%c %2s%-2s %c %s Lost carrier.%s: unknown parity value Connected connected must be interactive%s, unknown optionv0123456789phone number too long (max = %d bytes)tip%dPHONESbad baud rate %d%s [EOT]can't clear O_NONBLOCKaccess denied out of core %s=%-5dn r t bf %s: unknown variable %s/.tiprcset %sbeautifybaudratebadialtimeoutdialeofreadeofreofwriteeofwexceptionsframesizephonesraiseraisecharrecscripttabexpandverbechochecklinedelayldelaychardelaycdelayetimeoutrawftphdxlocalechohardwareflowAT Cannot synchronize with hayes... timeout waiting for reply ATH0 03cannot hang up modem please use 'tip dialer' to make sure the line is hung up ATv1 dialing...ATv0 ATTD01234NO CARRIERERROR in inputCONNECT 1200Unknown Modem error: %c (0x%x)NetBSD gzip 20170803malloc failedfailed to read stdin%s: unexpected end of file%s: trailing garbage ignoredinput not gziped (MAGIC0)input not gziped (MAGIC1)unknown compression method1.2.10failed to inflateInitZ_NEED_DICT errordata stream errorinternal stream errormemory allocation errorunknown error from inflate(): %derror writing to outputtruncated inputinvalid compressed data--crc errorinvalid compressed data--length errordecompression errordeflateInit2 faileddeflate faileddeflateEnd failed%c%c%c%c%c%c%c%c compressed uncompressed ratio uncompressed_nameread of uncompressed size%12llu %12llu %2.2d.%5s%%(stdin)can't read stdin(stdin): unexpected end of fileusage: %s [-123456789cdhlV] [ [ ...]] 123456789cdhlVcan't stat: %s%s is a directorycan't stat %s%s: unknown suffix -- ignoredcan't read %scouldn't close inputcouldn't close output%s: uncompress failedcouldn't open (leaving original): %scouldn't stat (leaving original): %sstat gave different size: %lld != %lld (leaving original)could not create output: %s%s is not a regular file.gz&&̯&S- SSUUMMMMAARRYY OOFF LLEESSSS CCOOMMMMAANNDDSS Commands marked with * may be preceded by a number, _N. Notes in parentheses indicate the behavior if _N is given. A key preceded by a caret indicates the Ctrl key; thus ^K is ctrl-K. h H Display this help. q :q Q :Q ZZ Exit. --------------------------------------------------------------------------- MMOOVVIINNGG e ^E j ^N CR * Forward one line (or _N lines). y ^Y k ^K ^P * Backward one line (or _N lines). f ^F ^V SPACE * Forward one window (or _N lines). b ^B ESC-v * Backward one window (or _N lines). z * Forward one window (and set window to _N). w * Backward one window (and set window to _N). ESC-SPACE * Forward one window, but don't stop at end-of-file. d ^D * Forward one half-window (and set half-window to _N). u ^U * Backward one half-window (and set half-window to _N). ESC-) RightArrow * Left one half screen width (or _N positions). ESC-( LeftArrow * Right one half screen width (or _N positions). F Forward forever; like "tail -f". r ^R ^L Repaint screen. R Repaint screen, discarding buffered input. --------------------------------------------------- Default "window" is the screen height. Default "half-window" is half of the screen height. --------------------------------------------------------------------------- SSEEAARRCCHHIINNGG /_p_a_t_t_e_r_n * Search forward for (_N-th) matching line. ?_p_a_t_t_e_r_n * Search backward for (_N-th) matching line. n * Repeat previous search (for _N-th occurrence). N * Repeat previous search in reverse direction. ESC-n * Repeat previous search, spanning files. ESC-N * Repeat previous search, reverse dir. & spanning files. ESC-u Undo (toggle) search highlighting. &_p_a_t_t_e_r_n * Display only matching lines --------------------------------------------------- A search pattern may be preceded by one or more of: ^N or ! Search for NON-matching lines. ^E or * Search multiple files (pass thru END OF FILE). ^F or @ Start search at FIRST file (for /) or last file (for ?). ^K Highlight matches, but don't move (KEEP position). ^R Don't use REGULAR EXPRESSIONS. --------------------------------------------------------------------------- JJUUMMPPIINNGG g < ESC-< * Go to first line in file (or line _N). G > ESC-> * Go to last line in file (or line _N). p % * Go to beginning of file (or _N percent into file). t * Go to the (_N-th) next tag. T * Go to the (_N-th) previous tag. { ( [ * Find close bracket } ) ]. } ) ] * Find open bracket { ( [. ESC-^F _<_c_1_> _<_c_2_> * Find close bracket _<_c_2_>. ESC-^B _<_c_1_> _<_c_2_> * Find open bracket _<_c_1_> --------------------------------------------------- Each "find close bracket" command goes forward to the close bracket matching the (_N-th) open bracket in the top line. Each "find open bracket" command goes backward to the open bracket matching the (_N-th) close bracket in the bottom line. m_<_l_e_t_t_e_r_> Mark the current position with . '_<_l_e_t_t_e_r_> Go to a previously marked position. '' Go to the previous position. ^X^X Same as '. --------------------------------------------------- A mark is any upper-case or lower-case letter. Certain marks are predefined: ^ means beginning of the file $ means end of the file --------------------------------------------------------------------------- CCHHAANNGGIINNGG FFIILLEESS :e [_f_i_l_e] Examine a new file. ^X^V Same as :e. :n * Examine the (_N-th) next file from the command line. :p * Examine the (_N-th) previous file from the command line. :x * Examine the first (or _N-th) file from the command line. :d Delete the current file from the command line list. = ^G :f Print current file name. --------------------------------------------------------------------------- MMIISSCCEELLLLAANNEEOOUUSS CCOOMMMMAANNDDSS -_<_f_l_a_g_> Toggle a command line option [see OPTIONS below]. --_<_n_a_m_e_> Toggle a command line option, by name. __<_f_l_a_g_> Display the setting of a command line option. ___<_n_a_m_e_> Display the setting of an option, by name. +_c_m_d Execute the less cmd each time a new file is examined. !_c_o_m_m_a_n_d Execute the shell command with $SHELL. |XX_c_o_m_m_a_n_d Pipe file between current pos & mark XX to shell command. v Edit the current file with $VISUAL or $EDITOR. V Print version number of "less". --------------------------------------------------------------------------- OOPPTTIIOONNSS Most options may be changed either on the command line, or from within less by using the - or -- command. Options may be given in one of two forms: either a single character preceded by a -, or a name preceded by --. -? ........ --help Display help (from command line). -a ........ --search-skip-screen Search skips current screen. -A ........ --SEARCH-SKIP-SCREEN Search starts just after target line. -b [_N] .... --buffers=[_N] Number of buffers. -B ........ --auto-buffers Don't automatically allocate buffers for pipes. -c ........ --clear-screen Repaint by clearing rather than scrolling. -d ........ --dumb Dumb terminal. -D [_x_n_._n] . --color=_x_n_._n Set screen colors. (MS-DOS only) -e -E .... --quit-at-eof --QUIT-AT-EOF Quit at end of file. -f ........ --force Force open non-regular files. -F ........ --quit-if-one-screen Quit if entire file fits on first screen. -g ........ --hilite-search Highlight only last match for searches. -G ........ --HILITE-SEARCH Don't highlight any matches for searches. -h [_N] .... --max-back-scroll=[_N] Backward scroll limit. -i ........ --ignore-case Ignore case in searches that do not contain uppercase. -I ........ --IGNORE-CASE Ignore case in all searches. -j [_N] .... --jump-target=[_N] Screen position of target lines. -J ........ --status-column Display a status column at left edge of screen. -k [_f_i_l_e] . --lesskey-file=[_f_i_l_e] Use a lesskey file. -K --quit-on-intr Exit less in response to ctrl-C. -L ........ --no-lessopen Ignore the LESSOPEN environment variable. -m -M .... --long-prompt --LONG-PROMPT Set prompt style. -n -N .... --line-numbers --LINE-NUMBERS Don't use line numbers. -o [_f_i_l_e] . --log-file=[_f_i_l_e] Copy to log file (standard input only). -O [_f_i_l_e] . --LOG-FILE=[_f_i_l_e] Copy to log file (unconditionally overwrite). -p [_p_a_t_t_e_r_n] --pattern=[_p_a_t_t_e_r_n] Start at pattern (from command line). -P [_p_r_o_m_p_t] --prompt=[_p_r_o_m_p_t] Define new prompt. -q -Q .... --quiet --QUIET --silent --SILENT Quiet the terminal bell. -r -R .... --raw-control-chars --RAW-CONTROL-CHARS Output "raw" control characters. -s ........ --squeeze-blank-lines Squeeze multiple blank lines. -S ........ --chop-long-lines Chop (truncate) long lines rather than wrapping. -t [_t_a_g] .. --tag=[_t_a_g] Find a tag. -T [_t_a_g_s_f_i_l_e] --tag-file=[_t_a_g_s_f_i_l_e] Use an alternate tags file. -u -U .... --underline-special --UNDERLINE-SPECIAL Change handling of backspaces. -V ........ --version Display the version number of "less". -w ........ --hilite-unread Highlight first new line after forward-screen. -W ........ --HILITE-UNREAD Highlight first new line after any forward movement. -x [_N[,...]] --tabs=[_N[,...]] Set tab stops. -X ........ --no-init Don't use termcap init/deinit strings. -y [_N] .... --max-forw-scroll=[_N] Forward scroll limit. -z [_N] .... --window=[_N] Set size of window. -" [_c[_c]] . --quotes=[_c[_c]] Set shell quote characters. -~ ........ --tilde Don't display tildes after end of file. -# [_N] .... --shift=[_N] Horizontal scroll amount (0 = one half screen width) ........ --no-keypad Don't send termcap keypad init/deinit strings. ........ --follow-name The F command changes files if the input file is renamed. --------------------------------------------------------------------------- LLIINNEE EEDDIITTIINNGG These keys can be used to edit text being entered on the "command line" at the bottom of the screen. RightArrow ESC-l Move cursor right one character. LeftArrow ESC-h Move cursor left one character. ctrl-RightArrow ESC-RightArrow ESC-w Move cursor right one word. ctrl-LeftArrow ESC-LeftArrow ESC-b Move cursor left one word. HOME ESC-0 Move cursor to start of line. END ESC-$ Move cursor to end of line. BACKSPACE Delete char to left of cursor. DELETE ESC-x Delete char under cursor. ctrl-BACKSPACE ESC-BACKSPACE Delete word to left of cursor. ctrl-DELETE ESC-DELETE ESC-X Delete word under cursor. ctrl-U ESC (MS-DOS only) Delete entire line. UpArrow ESC-k Retrieve previous command line. DownArrow ESC-j Retrieve next command line. TAB Complete filename & cycle. SHIFT-TAB ESC-TAB Complete filename & reverse cycle. ctrl-L Complete filename, list all. --More--(?eEND ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t)?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataLESSLESSSECUREVISUALLESSEDIT%E ?lm+%lm. %f@/\less/\help/\file/\@WARNING: terminal is not fully functionalNo filenames allowed with -t optionLESS_TERMCAP_DEBUGLESS_TERMCAP_LINESkrklkukdkPkNkh@7kDhcxndatiso|^Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketch_ungetchar overrunWarning: log file is incompleteseek errorread errorFinishing logfileseek error to 0invalid chardefchardef longer than 256invalid charset nameLESSCHARSETLESSCHARDEFLC_ALLLC_CTYPELANGUTF-8utf-8UTF8utf8latin1LESSBINFMT*s<%02X>LESSUTFBINFMTESC^%cANSI_X3.4-1968US-ASCIIiso8859ISO-8859-1latin9ISO-8859-15latin2ISO-8859-2ISO-8859-3latin3latin4ISO-8859-4cyrillicISO-8859-5ISO-8859-6arabicISO-8859-7greekIBM9005greek2005ISO-8859-8hebrewlatin5ISO-8859-9latin6ISO-8859-10latin7ISO-8859-13latin8ISO-8859-14latin10ISO-8859-16IBM437EBCDIC-USIBM1047IBM-1047KOI8-Rkoi8-rKOI8-UGEORGIAN-PSgeorgianpsTCVN5712-1tcvnNEXTSTEPwindows-1252CP1251windows-1251CP1252CP1255windows-12558bcccbcc18b95.b8bcccbcc18b95.b126.bb8bcccbcc18b95.33b.8bcccbcc18b95.33b5.b8.b15.b4.b12.b18.b12.b.8bcccbcc18b95.33b.3b.7b2.13b.3b.b26.5b19.b8bcccbcc18b95.33b4.2b4.b3.b35.b44.b8bcccbcc18b95.33b14.b35.b44.b8bcccbcc18b95.33b.b29.32b28.2b2.b8bcccbcc18b95.b.KOI8-T8bcccbcc18b95.b8.b6.b8.b.b.5b7.3b4.b4.b3.b.b.3b.8bcccbcc18b95.3b11.4b12.2b.b..b...bcccbccbbb7.8b95.b48.5b.TIS-6208bcccbcc18b95.b.4b.11b7.8b.8bcccbcc18b95.bb125.bb8bcccbcc12bc5b95.b.8bcccbcc12bc5b95.b24.b.8bcccbcc12bc5b95.b.b11.b.2b12.b.8bcccbcc12bc5b95.b.b8.b.5b9.b.4b.5bc6bcc7bcc41b.9b7.9b5.b..8b6.10b6.b9.7b9.8b8.17b3.3b9.7b9.8b8.6b10.b.b.b.4cbcbc3b9cbccbccbb4c6bcc5b3cbbc4bc4bccbc191.bLESSHISTFILE.lesshstLESSHISTSIZE"%s LESSSEPARATOR.less-history-file:.search.shellNon-match First-file EOF-ignore Keep-pos Regex-off &/(P)Pattern not found!done|doneless %s(N-th) [Press 'h' for instructions.]There is no --%s optionThere is no %s optionCommand not availableExamine: Cannot edit standard inputWARNING: This file was viewed via LESSOPENNo next fileNo %snext fileNo previous fileNo %sprevious fileNo next tagNo previous tagNo such filegoto mark: |mark: Brackets: Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableCannot use lesskey file "%s"/usr/bin/.sysless/etc/syslessLESSKEY_SYSTEM.lessLESSKEYWarning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"@/\less/\empty/\file/\@"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETACHARS; *? '"()<>[]|&^`#\$%=~LESSMETAESCAPE%c%s%clessechoLESSECHO%s -p0x%x -d0x%x -e%s -n0x%x %s*Invalid LESSOPEN variableLESSCLOSEInvalid LESSCLOSE variable...skipping... Cannot seek to that file positionCannot seek to beginning of fileCannot seek to line number %nCannot seek to end of fileDetermining length of fileDon't know length of fileLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbers (press RETURN)Cannot seek to start positionInvalid mark letterMark not setMark not in current filelog file support is not availableInput is not a pipeLog file is already in useNo log fileLog file "%s"jInvalid line fractionInvalid line numberPosition target at screen line %d.%06dPosition target at screen position %sInvalid column fractionInvalid column numberHorizontal shift %d columnsHorizontal shift %s of screen widthtags support is not availableTags file "%s"less POSIX regular expressions) Copyright (C) 1984-2012 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops and then every %d spaces-" must be followed by 1 or 2 charsquotes %sUse "h" for helpValue is required after %s--%s-%c (--%s)Number is required after %sThe %s option should not be followed by =%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric optionNegative option is invalidLESS_IS_MORESearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenBe less helpful in promptsBe helpful in promptsAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numberslog file: Log file: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linestag: tags file: Display underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file nameUse backslash escaping in command line parametersDon't use backslash escaping in command line parametersuse-backslashfollow-nameold-botno-keypadtildequoteswindowmax-forw-scrollno-inithilite-unreadunderline-specialtag-filechop-long-linessqueeze-blank-linesraw-control-charsquietsilentLOG-FILElog-fileline-numberslong-promptno-lessopenquit-on-intrlesskey-filestatus-columnjump-targetignore-casemax-back-scrollhilite-searchquit-if-one-screenquit-at-eofclear-screenauto-bufferssearch-skip-screenInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchtagsLESSGLOBALTAGS%s -x%s %sGTAGSGRTAGSGSYMSGPATHNo tags fileNo such tag in tags fileunknown tag typeTag not found\ %lu: %s: \ can not be used as a string delimiter%lu: %s: newline can not be used as a string delimiter%lu: %s: unbalanced brackets ([])%lu: %s: whitespace after %s%lu: %s: RE error: %s%lu: %s: unterminated regular expression%lu: %s: expected context address%lu: %s: undefined label '%s'%lu: %s: unexpected EOF (pending }'s)0123456789/\$%lu: %s: command expected%lu: %s: command %c expects up to %d address(es), found %d%lu: %s: unexpected }%lu: %s: extra characters at the end of %c command%lu: %s: command %c expects \ followed by text%lu: %s: filename expected%lu: %s: empty label%lu: %s: duplicate label '%s'%lu: %s: substitute pattern can not be delimited by newline or backslash%lu: %s: unterminated substitute pattern%lu: %s: \%c not defined in the RE%lu: %s: unescaped newline inside substitute pattern%lu: %s: unterminated substitute in regular expression%lu: %s: more than one number or 'g' in substitute flags%lu: %s: overflow in the 'N' substitute flag%lu: %s: no wfile specified%lu: %s: bad flag in substitute command: '%c'%lu: %s: transform pattern can not be delimited by newline or backslash%lu: %s: unterminated transform source string%lu: %s: unterminated transform target string%lu: %s: transform strings are not the same length%lu: %s: extra text at the end of a transform command%lu: %s: invalid command code %c%lu: %s: extra characters after \ at the end of %c commandw commandread commandbranch%lu: %s: unused label '%s'setting line buffered output failedsetting unbuffered output failedUsage: %s [-aElnru] command [file ...] %s [-aElnru] [-e command] [-f command_file] [-I[extension]] [-i[extension]] [file ...] EI::ae:f:i::lnru ..."-I or -i may not be used with stdinrename()fclose()in-place editing only%s: %s %sworks for regular files%s/.!%ld!%smalloc(%zu)realloc(%zu)calloc(%zu, %zu)first RE may not be empty\%c\%03o%lu: %s: \%u not defined in the RE\abfrtv><@=!:illegal -m option format: %swrite to stderrTerminal type? [%s] Terminal type? terminal type %s is hardcopyterminal type %s is unknownusage: %s [-EIQrSs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] set to%s %s backspace. delete. control-%c (^%c). . %c. ; unset noglob; set noglob; setenv TERM ; export TERM; TERM=standard errorarpanetdialupplugboard-a:d:e:EIi:k:m:np:QSrsTerminal type is %s. EraseKillInterruptUsage: %s [-G group,group,...] [-g group] [-u user] newroot [command] no such group `%s'G:g:u:no such user `%s'too many supplementary groups providedsetgroupssetgid-iYOw@.x....S... .'.0.9.C.LT.aF.ho(.yx..Y..y.y.... .$.-.6.@.L.].hv..7.6.tp_wwwwwwwwAbwww6wx xxxx#x'x/x3x9xDxSx_xNAME=rNmount_disks       !"#$%&' str_arg_substget_available_cds_wwwwwwwwAbwww6wx xxxx#x'x/x3x9xDxSx_x edit_fs_type_ext, (4 :  l l   L 0J a q edit_and_check_label _wwwwwwwwAbwww6wx xxxx#x'x/x3x9xDxSx_xdisklabel_freedisklabel_change_geomefvW Lm m q f q 4] [ Lp e ] <[ 8[ v f i `h d] V n r a |` V V _ \ \ [ ^ [ disklabel_set_part_infodisklabel_write_to_diskj$movouter_fill_part_menu_optsedit_outer_partsselect_part_scheme----------------------------------- - --------------------/boot@//tmp/usr/var normalize_clonesreplace_by_default//// pm_from_pepm_whole_diskgpt_create_newrJJ,YXZWWRLdM$ShQaGJtGNGpGv |ef KxG gpt_get_part_devicegpt_freegpt_get_part_alignmentW$3 Details for index gpt_get_uuid_part_typegpt_read_from_diskGPT part - SFH0eC0SFU0eC%xHah!IdontNeedEFI/4(s*K>;g>|nQn- q+IU|nQn- q+dn|nQn- q+{|nQn- q+|nQn- q+=rGy=iG};Mt?mWC 3KOOyD<#*=(3Dh&!\ M}-4E-чHxV-чHkZIчHIчHIчH2IчH_S'@ )Ѹ*1@ )ѸSx1x )Ѹ J ] u T  xA Lܬ     inside_ext_partadjust_ext_partmbr_init_default_alignmentsmbr_create_newjPxDxxЄv؉wvPT<p|t}v |x: page down%-35s %.50sCould not initialize menu system, please check your terminal type. Window too short (m->h %d, m->numopts %d, exithadd %d, y %d, max_lines %d, hadd %d) for menu "%.30s" Screen too narrow (%d + %d > %d) for menu "%s" Could not create window (%d + %d, %d + %d, %d, %d) for menu "%s" Help: exit: x, page up: u <, page down: d >ExitZeroconfrun mdnsd onlyrun mdnsd and resolve local namesdo not run mdnsdgoogle-public-dns-a.google.com (IPv4)google-public-dns-b.google.com (IPv4)google-public-dns-a.google.com (IPv6)google-public-dns-b.google.com (IPv6) [MSGTXTSmsg_prompt_win: newwin(%d, %d, %d, %d) failed Installation messages in Englishen_US.ISO8859-1Out of memory!YesSomeOnOffunchangedDelete?reinstall sets forupgradeNetBSD/evbarm 9.2 This menu-driven tool is designed to help you install NetBSD to a hard disk, or upgrade an existing NetBSD system, with a minimum of work. In the following menus type the reference letter (a, b, c, ...) to select an item, or type CTRL+N/CTRL+P to select the next/previous item. The arrow keys and Page-up/Page-down may also work. Activate the current selection from the menu by typing the enter key. Thank you for using NetBSD! You have chosen to install NetBSD on your hard disk. This will change information on your hard disk. You should have made a full backup before this procedure! This procedure will do the following things: a) Partition your disk b) Create new BSD file systems c) Load and install distribution sets d) Some initial system configuration (After you enter the partition information but before your disk is changed, you will have the opportunity to quit this procedure.) Shall we continue? Ok, let's upgrade NetBSD on your hard disk. As always, this will change information on your hard disk. You should have made a full backup before this procedure! Do you really want to upgrade NetBSD? (This is your last warning before this procedure starts modifying your disks.) Ok, let's unpack the NetBSD distribution sets to a bootable hard disk. This procedure just fetches and unpacks sets onto a pre-partitioned bootable disk. It does not label disks, upgrade bootblocks, or save any existing configuration info. (Quit and choose `install' or `upgrade' if you want those options.) You should have already done an `install' or `upgrade' before starting this procedure! Do you really want to reinstall NetBSD distribution sets? (This is your last warning before this procedure starts modifying your disks.) Mounting %s failed. Continue? I can not find any hard disks for use by NetBSD. You will be returned to the original menu. I found only one disk, %s. Therefore I assume you want to %s NetBSD on it. On which disk do you want to %s NetBSD? Available disksmount point (or 'none')MBGBYou can use a simple editor to set the sizes of the NetBSD partitions, or apply the default partition sizes and contents.If you do not want to use the existing partitions, you can use a simple editor to set the sizes of the NetBSD partitions, or remove existing ones and apply the default partition sizes. You will then be given the opportunity to change any of the partition details. The NetBSD (or free) part of your disk ($0) is $3. A full installation requires at least $4 without X and at least $5 if the X sets are included.Choosing mega- or gigabytes will give partition sizes close to your choice, but aligned to cylinder boundaries. Choosing sectors will allow you to more accurately specify the sizes. On most disks, there is little to gain from cylinder alignment. On very old disks, it is most efficient to choose partition sizes that are exact multiples of your actual cylinder size. Choose your size specifierYou can now change the sizes for the system partitions. The default is to allocate all the space to the root file system. However, you may wish to have separate /usr (additional system files), /var (log files etc) or /home (users' home directories) file systems. Free space will be added to the partition marked with a '+'.Other markers: $0 partition.'=' existing'@' externalMount point?Size for %s in %s?Change input units (sectors/cylinders/MB/GB)NetBSD partitionWhole diskBoot partitionAdd a user defined partitionGo on. Free space $0 $1.Abort. Not enough space, $0 $1 missing!The start value you specified is beyond the end of the disk. With this value, the partition end is beyond the end of the disk. Your partition size has been truncated. This disk ($0) is too large ($3) for a $2 partition table (max $4), hence only the start of the disk is usable. What would you like to do to the existing partitions?keep (use only part of disk)delete (all data will be lost!)convert to another partitioning methodWe now have your $2 partitions for $0 below. This is your last chance to change them. Flags: $3(N)ewfs$4. Total size: $5, free: $6EndFS typePartition sizes okThe current values for this partition are displayed below. Select the field you wish to change:mount optionsToggleRestore original valuesSelect the typeother typesSpecial values that can be entered for the size value: -1: use until the end $0: use until the given partitionSize (max $1 $2)Special values that can be entered for the offset value: -1: start at the beginning $0: start at the end of given partition $1: start at the beginning of given free spaceStart ($2)Badly formed numberPlease enter a name for your NetBSD diskOk, we are now ready to install NetBSD on your hard disk (%s). Nothing has been written yet. This is your last chance to quit this process before anything gets changed. Shall we continue? Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and newfs'ed and fsck'ed the new partitions you specified for the target disk. Ok, the first part of the procedure is finished. Sysinst has written a disklabel to the target disk, and fsck'ed the new partitions you specified for the target disk. Could not open %s, error message was: %s. mount of device $0 on $1 failed. The extraction of the selected sets for NetBSD-9.2 is complete. The system is now able to boot from the selected hard disk. To complete the installation, sysinst will give you the opportunity to configure some essential things first. The installation of NetBSD-9.2 is now complete. The system should boot from hard disk. Follow the instructions in the INSTALL document about final configuration of your system. We also recommend reading the afterboot(8) manpage; it contains a list of things to be checked after the first complete boot. At a minimum, you should edit /etc/rc.conf to match your needs. See /etc/defaults/rc.conf for the default values. The upgrade to NetBSD-9.2 is now complete. You will now need to follow the instructions in the INSTALL document as to what you need to do to get your system reconfigured for your situation. Remember to (re)read the afterboot(8) manpage as it may contain new items since your last upgrade. Unpacking additional release sets of NetBSD-9.2 is now complete. You will now need to follow the instructions in the INSTALL document to get your system reconfigured for your situation. The afterboot(8) manpage can also be of some help. If you unpacked the etc set, you will need to edit /etc/rc.conf to get a multi-user system. At a minimum, you will need to change rc_configured=NO to rc_configured=YES. Your disk is now ready for installing the kernel and the distribution sets. As noted in your INSTALL notes, you have several options. For ftp or nfs, you must be connected to a network with access to the proper machines. Sets selected %d, processed %d, Next set %s. The NetBSD distribution is broken into a collection of distribution sets. There are some basic sets that are needed by all installations and there are some other sets that are optional. You may choose to install a core set (Minimal installation), all of them (Full installation), or a custom group of sets (Custom installation). The following are the $1 site, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. e-mail addressEnter the nfs host and server directory where the distribution is located. Remember, the directory should contain the $0 files and must be nfs mountable. Enter the floppy device to be used and transfer directory on the target file system. The set files must be in the root directory of the floppies. Enter the CDROM device to be used and directory on the CDROM where the distribution is located. Remember, the directory should contain the $0 files. Could not locate a CD medium in any drive with the distribution sets! Enter the correct data manually, or insert a disk and retry. Cancel installationBack to source selection & retryAvailable CDs Multiple CDs found. Please select the one containing the install CD.The installation sets have not been found at the default location on this CD. Please check the device and path name.Enter the unmounted local device and directory on that device where the distribution is located. Remember, the directory should contain the $0 files. Enter the already-mounted local directory where the distribution is located. Remember, the directory should contain the $0 files. I can not find any network interfaces for use by NetBSD. You will be returned to the previous menu. The following network interfaces are active: %s Does one of them connect to the required server?Which network device would you like to use?Available interfacesTo be able to use the network, we need answers to the following: Your DNS domainYour host nameYour IPv4 addressServer IPv4 addressIPv4 NetmaskYour name serverIPv4 gatewayNetwork media typeThe following are the values you entered. DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Netmask: %s IPv4 Gateway: %s The following are the values you entered. Are they OK? DNS Domain: %s Host Name: %s Nameserver: %s Primary Interface: %s Media type: %s Host IP: %s Server IP: %s Netmask: %s IPv4 Gateway: %s IPv6 autoconf: %s Are they OK? Waiting while network interface comes up. Could not create /etc/resolv.conf. Install aborted. Could not change to directory $0: $1. Install aborted.Delete after installRelease set $0 does not exist.All selected distribution sets unpacked successfully.There were problems unpacking distribution sets. Your installation is incomplete. You selected %d distribution sets. %d sets couldn't be found and %d were skipped after an error occurred. Of the %d that were attempted, %d unpacked without errors and %d with errors. Aborting installation. Please recheck your distribution source and consider reinstalling sets from the main menu.Partitioning aborted.The distribution was not successfully loaded. You will need to proceed by hand. Installation aborted. The distribution was not successfully loaded. You will need to proceed by hand. Upgrade aborted. Unpacking additional sets was not successful. You will need to proceed by hand, or choose a different source for release sets and try again. There is a big problem! Can not create /mnt/etc/fstab. Bailing out! Help! No /etc/fstab in target disk %s. Aborting upgrade. Help! Can't parse /etc/fstab in target disk %s. Aborting upgrade. I cannot save %s/bin/X as %s/bin/X.old, because the target disk already has an %s/bin/X.old. Please fix this before continuing. One way is to start a shell from the Utilities menu, examine the target %s/bin/X and %s/bin/X.old. If %s/bin/X.old is from a completed upgrade, you can rm -f %s/bin/X.old and restart. Or if %s/bin/X.old is from a recent, incomplete upgrade, you can rm -f %s/bin/X and mv %s/bin/X.old to %s/bin/X Aborting upgrade.There was a problem in setting up the network. Either your gateway or your nameserver was not reachable by a ping. Do you want to configure your network again? ("No" allows you to continue anyway or abort the install process.) Would you like to continue the install process anyway, and assume that the network is working? ("No" aborts the install process.) Making device nodes ... It appears that $0 is not a $1 file system or the fsck was not successful. Try mounting it anyway? (Error number $2.) target root is missing %s. The completed new root file system failed a basic sanity check. Are you sure you installed all the required sets? Floppy file system typeCould not find the file on the floppy. The floppy was not mounted successfully. Please load the floppy containing the file named "%s.%s". If the set has no more disks, select "Set finished" to install the set. Select "Abort fetch" to return to the install media selection menu. Is the network information you entered accurate for this machine in regular operation and do you want it installed in /etc? The following is the list of distribution sets that will be used. Distribution set Selected ------------------------ -------- BaseConfiguration files (/etc)Compiler toolsGamesManual pagesMiscellaneousKernel modulesRecovery toolsTest programsText processing toolsX11 setsX11 base and clientsX11 configurationX11 fontsX11 serversX11 programmingSource and debug setsKernel sourcesBase sourcesShare sourcesGNU sourcesX11 sourcesDebug symbolsX11 debug symbolsSelect all the above setsDeselect all the above setsInstall selected setsThere was an error in extracting the file %s. That means some files were not extracted correctly and your system will not be complete. Continue extracting sets?There must be a single partition marked to be mounted on '/'.partitions $0 and $1 overlap.No bootcode for specified FS type of root partitionSorry, the root file system can't be FFSv2 due to lack of bootloader support on this port. You can either edit the partition table by hand, or give up and return to the main menu. Edit the partition table again?Could not open config file $0Please choose the timezone that fits you best from the list below. Press RETURN to select an entry. Press 'x' followed by RETURN to quit the timezone selection. Default: %s Selected: %s Local time: %s %s Back to main timezone listThe disk that you selected has a swap partition that may currently be in use if your system is low on memory. Because you are going to repartition this disk, this swap partition will be disabled now. Please beware that this might lead to out of swap errors. Should you get such an error, please restart the system and try again.Sysinst failed to deactivate the swap partition on the disk that you chose for installation. Please reboot and try again.The root password of the newly installed system has not yet been initialized, and is thus empty. Do you want to set a root password for the system now?You can now select which shell to use for the root user. The default is /bin/sh, but you may prefer another one. There is no defined root file system. You need to define at least one mount point with "/". Press to continue. Enter slattach flags Pick an option to turn on or off.ScriptingLogging Status: Command: FinishedCommand failedCommand ended on signalNetBSD-9.2 Install SystemExit Install SystemInstall NetBSD to hard diskUpgrade NetBSD on a hard diskRe-install sets or install additional setsReboot the computerUtility menuConfig menuBack to main menuNetBSD-9.2 UtilitiesRun /bin/shSet timezoneConfigure networkPartition a diskLogging functionsHalt the systemYes or no?Hit enter to continueChoose your installationUse existing $1 partitionsSet sizes of NetBSD partitionsUse default partition sizesDelete everything, use different partitions (not $1)GigabytesMegabytesCylindersInstall fromFTPHTTPNFSCD-ROM / DVD / install image mediaFloppyUnmounted fsLocal directorySelect your distributionFull installationInstallation without X11Minimal installationCustom installation** hidden **Base directoryBinary set directorySource set directoryTransfer directoryDownload viaUserPasswordProxyGet DistributionContinueWhat do you want to do?Try againSet finishedSkip setSkip set groupAbandon installationAbort fetchFile system Select DNS serverother Perform autoconfiguration?Root shellUser shellColor schemeWhite on blackBlack on whiteWhite on blueGreen on blackThe directory where the old a.out shared libraries should be moved to could not be created. Please try the upgrade procedure again and make sure you have mounted all file systems.Either the /emul/aout or /emul directory on your system was a symbolic link pointing to an unmounted file system. It has been given a '.old' extension. Once you bring your upgraded system back up, you may need to take care of merging the newly created /emul/aout directory with the old one. Sendmail is no longer in this release of NetBSD, default MTA is postfix. The file /etc/mailer.conf still chooses the removed sendmail. Do you want to upgrade /etc/mailer.conf automatically for postfix? If you choose "No" you will have to update /etc/mailer.conf yourself to ensure proper email delivery.To use the network interface %s, you must agree to the license in file %s. To view this file now, you can type ^Z, look at the contents of the file and then type "fg" to resume.To configure the binary package system, please choose the network location to fetch packages from. Once your system comes up, you can use 'pkgin' to install additional packages, or remove packages.Enabling binary packages with pkgin requires setting up the repository. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. Making backup of rc.conf failed. Continue?rc.conf backup saved to %s.Restoring backup rc.conf failed.Deleting old %s entry failed.Package directoryconfigure a prior installation ofpassword setYESDONEAbandoned***EMPTY***TimezoneChange root passwordEnable installation of binary packagesEnable sshdEnable ntpdRun ntpdate at bootEnable mdnsdEnable xdmEnable cgdEnable lvmEnable raidframeAdd a userConfigure the additional items as needed.Finished configuringInstall pkgin and update package summaryYour system is now configured to use pkgin to install binary packages. To install a package, run: pkgin install from a root shell. Read the pkgin(1) manual page for further information.Fetch and unpack pkgsrcInstalling pkgsrc requires unpacking an archive retrieved over the network. The following are the host, directory, user, and password that will be used. If "user" is "ftp", then the password is not needed. pkgsrc directoryNetwork configuration failed. Retry?Quit without installing pkgsrcQuit installing binary pkgsInstallation of pkgin failed, possibly because no binary packages exist. Please check the package path and try again.Operation not supported!Mountpoint (or 'raid', 'cgd', 'lvm')?Extended partitioningEdit partitionsSwitch partitioning schemeFormat as RAIDFormat as LVM PVEncrypt (CGD)Bootable flagSafe eraseUndo changesUnconfigureEditForce umountAddThis removes all partitions on the disk!Save changes before finishing?Changes cannot be saved.No root partition defined. Cannot continue 8 character username to addDo you wish to add this user to group wheel?Delete partitionThe selected partition does not seem to have a valid file system. Do you want to newfs (format) it?A swap partition (named $1) seems to exist on $0. Do you want to use that?BSD disklabeldisklabel (NetBSD only)The disk seems not to have been partitioned before. Please select a partitioning scheme from the available options below. Please select a different partitioning scheme from the available options below. Some schemes have size limits and can only be used for the start of huge disks. The limit is displayed below.This device ($0) is $1 big.Max:Add a partition (no partition defined)UnknownInvalid file system type code (0 .. 255)CancelInvalid valueInvalid GUIDRe-editAbort installationFile system type code (upto 255)Too many partitions$0 already defined!This is an already existing partition. To change its size, the partition will need to be deleted and later recreated. All data in this partition will be lost. Would you like to delete this partition and continue?Non-deletable system partitionavg file size$0 bytes (for number of inodes)4 fragmentsSelect file system block sizeSelect file system fragment sizeaverage file size (bytes)Invalid numeric!Too large!Space at $0..$1 $3 (size $2 $3) FFSLinux Ext2 (old)Other typeEdit name of the diskThe name of the disk is arbitrary. It is useful for distinguishing between multiple disks. It may also be used when auto-creating dk(4) "wedges" for this disk. Enter disk nameDo you want to re-edit the $1 partitions?We are now going to install NetBSD on the disk $0. NetBSD requires a single partition in the disk's $1 partition table, this is split further by the $2. NetBSD can also access file systems in other $3 partitions. If you select 'Use the entire disk' then the previous contents of the disk will be overwritten and a single $3 partition used to cover the entire disk. If you want to install more than one operating system then edit the $3 partition table and create a partition for NetBSD. About $5 is enough for a basic installation, but you should allow extra for additional software and user files. Allow at least $6 if you want to build NetBSD itself.What would you like to do?Edit the $1 partition tableUse the entire disk Total size of $0 is $1, available: $2FlagPartition table OKDon't changeOtherThere is no NetBSD partition in the $1.There are multiple NetBSD partitions in the $1. You should set the 'install' flag on the one you want to use.Your disk currently has a non-NetBSD partition. Do you really want to overwrite that partition with NetBSD? Partition OKThe Current $2 partition table of $0 is shown below. Flags: (I)nstall here$3. Select the partition you wish to change: , (C)lone(I)nstall, Guid Partition Table (GPT)LabelGPT TypeUse this partitions anyway, (B)ootable(Other: $0)current systemClone external partition(s)Please select an external source partition:Your currently selected source partitions are:Clone with dataAdd another partitionAdd at endInsert cloned partitions before:cloned partition(s)Source selection OK, proceed to target selectionCannot read filecore boot block Cannot read RISCiX partition table No NetBSD partition found in RISCiX partition table - Cannot label No NetBSD partition found (filecore only disk ?) - Cannot label Installing boot blocks on %s.... We now have your NetBSD partitions on %s as follows (Size and Offset in %s): Kernel (ADI_BRH)Kernel (INTERGRATOR)Kernel (IQ80310)Kernel (IQ80321)Kernel (MINI2440)Kernel (TEAMASA_NPWR)Kernel (TS7200)Kernel (RPI)Kernel (KUROBOX_PRO)There is no MSDOS boot partition in the MBR partition table.The RPI kernel was not installed, perhaps you didn't select it?KindMountYou have not marked a partition active. This may cause your system to not start up properly. Should the NetBSD partition of the disk be marked active? You will be prompted for the geometry. Please enter the number of sectors per track (maximum 63) and number of heads (maximum 256) that the BIOS uses to access the disk. The number of cylinders will be calculated from the disk size. Sysinst could not automatically determine the BIOS geometry of the disk. The physical geometry is %d cylinders %d sectors %d heads Using the information already on the disk, my best guess for the BIOS geometry is %d cylinders %d sectors %d heads real geom: %d cyl, %d heads, %d sec (NB: for comparison only) BIOS geom: %d cyl, %d heads, %d sec Partition kind (0..255)There can only be one extended partition, (a)ctiveWriting the $2 partition table to $0... Rewrite of MBR failed. I can't continue.The partition needs to start within the Extended PartitionThe Extended Partition must be able to hold all contained partitionsCan not delete a non-empty extended partition!This partition is not inside the extended partition and there is no free slot in the primary boot recordNo space in the primary boot block. You may consider deleting one partition, creating an extended partition and then re-adding the deleted oneMaster Boot Record (MBR)Invalid partition type (0 .. 255)Fill with zerosFill with random data0 - No parity, simple striping.1 - Mirroring. The parity is the mirror.4 - Striping with parity stored on the last component.5 - Striping with distributed parity. Device is blocked. Editing it may cause problems. Do you want to force unblock it and continue?Do you want to try?Create cryptographic volume (CGD)Create virtual disk image (VND)Create volume group (LVM VG)Create logical volumeCreate software RAIDUpdate device listSave changesBLOCKEDUNCHANGEDUSED(mounted)(unused)GPT-labeled diskFinish partitioningLimit for the device count was reached!Invalid device!Available disks:Cannot allocate device node!This is the extended partition manager. All disks, partitions, etc. are listed below. To use RAID, LVM, or CGD: 1) Create partitions with the appropriate type; 2) Create RAID/LVM VG/CGD using these partitions; 3) Save changes; 4) Create partitions for RAID/CGD or Logical Volumes for LVM.$0 (level $1)EMPTY RAID!DisksSparesRAID levelnumRownumColnumSparesectPerSUSUsPerParityUnitSUsPerReconUnitMulti-dimensional arrays are NOT supported!numRow?numCol?numSpare?sectPerSU?SUsPerParityUnit?SUsPerReconUnit?Disks in RAID:PATH NOT DEFINED!ASSIGNFile pathCreate new imageRead-onlySet geometry by handBytes per SectorSectors per TrackTracks per CylinderFile path?Size (MB)?Bytes per Sector?Sectors per Track?Tracks per Cylinder?Cylinders?DISK NOT DEFINED!Base deviceEncryptionKey sizeIV algorithmKey generationVerification methodDisks in VGEMPTY VG!PV'sNameMaxLogicalVolumesMaxPhysicalVolumesPhysicalExtentSizeName?MaxLogicalVolumes?MaxPhysicalVolumes?PhysicalExtentSize?Logical volumeContiguousLogicalExtentsNumberMinor numberMirrorsMirrorLogRegionSizePersistent minor numberReadAheadSectorsStripesStripeSizeZeroing of the first KBLogicalExtentsNumber?Minor number?Mirrors?MirrorLogRegionSize?ReadAheadSectors?Stripes?Log ended at: %s # Script ended at: %s sysinst terminated. /usr/share/sysinst/catalog//usr/share/sysinst/catalogsysinstmsgs.sysinst: environment variable TERM not set. %u:%uusage: sysinst [-D] [-f definition_file] [-r release] [-C bg:fg] [-p] where: -D run in debug mode -f definition_file override built-in defaults from file -r release override release name -C bg:fg use different color scheme -p only run the partition editor, no installation Dr:f:C:psysinst: screen too small xfer dir/usr/INSTALLext dirext src dirftp hostftp.NetBSD.orgcdn.NetBSD.orgftp dirpub/NetBSD/NetBSD-9.2ftp prefix/evbarm-earm/binary/setsftp src prefix/source/setsftp userftp passftp proxynfs hostnfs dir/bsd/releasecd devfd dev/dev/fd0alocal devlocal fslocal dirtargetroot mount/targetrootdist postfixdist tgz postfixpkg hostpkg http hostpkg dirpub/pkgsrc/packages/NetBSDpkg prefix/earm/9.2/Allpkg userpkg passpkg proxypkgsrc hostpkgsrc http hostpkgsrc dirpkgsrc prefixpub/pkgsrc/stablepkgsrc userpkgsrc passpkgsrc proxy/bin/X/usr/X11R6/usr/X11R7/tmp/sysinst.sh#!/bin/sh # Script started at: %s script filesysinst: failed to allocate output window. openpty() failed fork() failedexecuting: %s &&chroot(%s) for %sexecvp %sselectselect failure: %s select(2) failed but no child died?/tmp/sysinst.logLog started at: %s could not open /tmp/sysinst.log: %s Dynamic menu creation failed. vasprintf(&scmd, "%s", ...)realloc(argv) for %s:%%.*s%s%%%02Xipwiwi/sbin/ifconfig -l 2>/dev/nullAborting: Could not run ifconfig. Could not run ifconfig.hw.%s.accept_eula%s=1manual/sbin/ifconfig %s media %s/sbin/ifconfig -m %s |while IFS=; read line; do [ "$line" = "${line#*media}" ] || echo $line; done/sbin/dhcpcd%s -d -n %s/sbin/route -n show | while read dest gateway flags; do [ "$dest" = default ] && { echo "$gateway"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword address rest; do [ "$keyword" = nameserver ] && { echo "$address"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword domain rest; do [ "$keyword" = domain ] && { echo "$domain"; break; }; donecat /etc/resolv.conf 2>/dev/null | while read keyword search rest; do [ "$keyword" = search ] && { echo "$search"; break; }; done0xff0000000xffff00000xffffff00/sbin/ifconfig lo0 127.0.0.1/etc/resolv.confcat </etc/resolv.conf Created by NetBSD sysinst on; ; BIND data file ; %s %s; search %s nameserver %s EOF /sbin/ifconfig %s inet %s %s up-s 115200 -l /dev/tty00/sbin/slattach /sbin/ifconfig %s inet %s netmask %s/sbin/ifconfig %s inet %s/sbin/route -n flush -inet/sbin/route -n add default %s/sbin/ifconfig -w 15 -W 5-_.+!,-_.+!,/%s://%s%s/%s-a /usr/bin/ftp %s%s/%s%s/sbin/mount -r -o -2,-i,-r=1024 -t nfs %s:%s /mnt2/mnt2/%shostname=%s /etc/ifconfig.%scat <>%s%s %s netmask %s media %s %s netmask %s /etc/hostscat <>%s/etc/hosts # # Added by NetBSD sysinst 127.0.0.1 localhost.%s %s defaultroutedefaultroute="%s" dhcpcd=YES dhcpcd_flags="-qM %s" /libdata/firmware/if_iwi/LICENSE.ipw2200-fw/libdata/firmware/if_ipw/LICENSEgreipipgiffaithlolo0ppptun%s -p -b 16 -c 4 %s%s -p -c 3 %s %s [%llu @ %llu] %s [%llu @ %llu]/sbin/fsck_%s%s -p -q %s%s (%s@%s)%s (%s, %s)%s (%s, %s %s)-t -o disk %s: is too big (%llu blocks, %s), will be truncated /sbin/newfs_ext2fs -O 0/sbin/newfs_ext2fs-tffs -o async-tlfs-tmsdos-tsysvbfs-tv7fs-text2fs-tffs -o log/dev//r%s/sbin/newfs -V2 -O2 %s-i %u/sbin/newfs %s-i %u -b %u -f %u /sbin/newfs -V2 -O %d %s-b %u/sbin/newfs_lfs %s/sbin/newfs_msdos/sbin/newfs_sysvbfs/sbin/newfs_v7fs/mnt,dp,log,noauto,async,noatime,nodev,nodevmtime,noexec,nosuid/etccat <%s/etc/fstab Making %s/etc/fstab (%s). Failed to make /etc/fstab! # NetBSD /etc/fstab # See /usr/share/examples/fstab/ for more examples. NAME=%s / ffs rw 1 1 NAME=%s none swap sw,dp 0 0 %s none swap sw%s 0 0 tmpfs /tmp tmpfs rw,-m=1777,-s=ram%%%llu tmpfs /tmp tmpfs rw,-m=1777,-s=%lluM /stand%s%s %s %s rw%s%s%s%s%s%s%s%s %d %d kernfs /kern kernfs rw ptyfs /dev/pts ptyfs rw procfs /proc procfs rw /dev/%s /cdrom cd9660 ro,noauto hw.usermem64%stmpfs /var/shm tmpfs rw,-m1777,-sram%%25 /kern/proc/dev/pts/cdrom/var/shm/sbin/newfs_%s/dev/%s %s ffs %s/dev/%s %s ufs %sNAME=NAME=%s %s ffs %s/dev/%%s %%s %s %%sNAME=%%s %%s %s %%s(size_t)(l - fstabbuf) == num_entries/usr/src/usr.sbin/sysinst/arch/evbarm/../../disks.cprogress -f %s -b 1m dd bs=1m of=%sxbdcd*fd*%-30s %s/dev/r%s%cCD001/sbin/mount -rt cd9660 /dev/%s /mnt2/bin/sh MAKEDEV allvasprintf(&spatterns, "%s", ...)sed -an -e '%s;H;$!d;g;w %s' %s/sbin/mount -rt %s /dev/%s /mnt2%s/%s/%s/sbin/umount /mnt2/etc/localtimeUTCzoneinfo/etc/rc.confcat <>%s/etc/rc.conf /etc/sysctl.confcat <>%s/etc/sysctl.conf s/^rc_configured=NO/rc_configured=YES/fsck_lfsmount_lfsnewfs_lfspreposterous clock time Can't convert to localtime 0x%jx (%s) /usr/share/zoneinfo/ Please consult the install documents./usr/share/zoneinfo/%saa/sbin/mount -r -t %s %s /mnt2sh -c '/bin/cat /mnt2/%s.%s %s %s/%s/%s%s'(size_t)(t-out) == len/usr/src/usr.sbin/sysinst/arch/evbarm/../../util.craidctlvndconfigcgdconfigm >= 0 && m <= nrm -rf usr/X11R7/lib/X11/xkb/symbols/pcprogress -zf %s tar --chroot -xpf - '%s'progress -zf %s tar --chroot -xpf -rm %s/.sysinst/usrmkdir -m 755 /mnt2 %d%d%s%d%d%d%d%d%d/usr/sbin/postinstall -s /.sysinst -d / check mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix mailerconf/usr/sbin/postinstall -s /.sysinst -d / fix/etc/rc.d/random_seed start/varrandom_file=/etc/entropy-file /boot.cfgsh -c 'sed -e s./var/db/./etc/. < /boot.cfg > /tmp/boot.cfg.tmp'/tmp/boot.cfg.tmp/etc/rc.d/random_seed stop/etc/rc.conf.tmp.XXXXXX/etc/rc.conf.bak.XXXXXXdevice-parentsdmmc/sbin/init/etc/rc/etc/rc.subr/sbin/fsck/sbin/fsck_ffs/sbin/mount/sbin/mount_ffskern-GENERICgamesrescuetestsxbasexcompxetcxfontxserversyssrcsharesrcgnusrcxsrcxdebug %12llu [%zu %s]%12llu %12llu %12llu %s%12llu %12llu %12llu %*.*s %*s %s%*s -%*s : %s%*s : %llu %s%*s : %u%*s : async noatime nodev nodevmtime noexec nosuid log noauto ndx == cnt/usr/src/usr.sbin/sysinst/arch/evbarm/../../label.c------------ ------------ ------------ %s ---------------- %12.12s %12.12s %12.12s %*s %*s %s %s%llu - %llu %s, %scnt == pset->parts->num_part+3+C_M_ITEMS+may_add+may_edit_packNTFS a-%c %c%c-%c%s %s %s %s %s%s %s %s/altroot/bin/mkdir -p %scd to %s cd %s /bin/cp %s %smv %s %scp -p %s %s/sbin/mount %s %s %s%s/sbin/umount %s/sbin/umount %s%sif [ $? != 0 ]; then echo "%s does not exist!"; fi raspberrypi,netbsd,generic-acpi./netbsd/boot/EFI/boot/usr/mdec/bootarm.efi/boot/dtb*.dt*./netbsd.ub./netbsd.img./bcm*.dtb%s/netbsd.img/bin/cp %s /targetroot/boot/kernel.imgsshd=YES /usr/sbin/useradd -m -s %s -G wheel %s/usr/sbin/useradd -m -s %s %spasswd -l %ss,^%s$,%s=%s,adding %s=%s replacement pattern is %s pkg_add %s/pkgins,^[^#].*$,%s,/usr/pkg/etc/pkgin/repositories.conf/usr/pkg/bin/pkgin -y update/usr/pkg/bin/pkgin -y install %s%-50s %-10schpass -s %s rootsource for 3rd-party packagespasswd -l rootchroot %s /usr/bin/awk -F: '$1=="root" { print $NF; exit }' /etc/passwdgetent passwd root | cut -d: -f2chroot %s getent passwd root | chroot %s cut -d: -f2buf %s strlen(buf) %zu ntpdate/tmp/checkrc.shCould not open %s for writing#!/bin/sh . /etc/defaults/rc.conf . /etc/rc.subr #!/bin/sh . /etc/rc.conf . /etc/rc.subr if checkyesno %s then echo YES else echo NO fi chroot %s /bin/sh %s 2>&1var %s is %s disklabel -D %s/dev/%s%carg != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.cparts->l.d_secsize != 0parts->l.d_nsectors != 0parts->l.d_ntracks != 0parts->l.d_ncylinders != 0parts->l.d_secpercyl != 0fictiousdisklabel -r %sinfo->fs_type == 0 || info->fs_type == parts->l.d_partitions[part].p_fstype/usr/src/usr.sbin/sysinst/arch/evbarm/../../disklabel.c:533: internal error%s (%u)/tmp/disklabel.%ucat <%s %s|NetBSD installation generated:\ :nc#%d:nt#%d:ns#%d:\ :sc#%d:su#%u:\ :se#%d:\ :p%c#%u:o%c#%u:t%c=%s:b%c#%u:f%c#%u:disklabel -w -r%s -f %s %s '%s' '%s'%13llu %13llu %-4s------------- ------------- ----%s(%s) %13s %13s %-4s (op - opts) >= 0 && (size_t)(op - opts) == num_opts/usr/src/usr.sbin/sysinst/arch/evbarm/../../part_edit.c%s. %sparts && parts->pschemeUser answered no to destroy other data, aborting. %s [%s %s]strlen(ms) < totalmv -f %s %s/%s/usr/lib/emul/aout/emul/emul.oldmv -f %s %smkdir %s aout.old/usr/aoutln -s %s %susr/lib.oldetc/ld.so.conf.oldmkdir -p %s /etc/ld.so.conf/usr/X11R6/liblibICE.so.6.3libPEX5.so.6.0libSM.so.6.0libX11.so.6.1libXIE.so.6.0libXaw.so.6.1libXext.so.6.3libXi.so.6.0libXmu.so.6.0libXp.so.6.2libXt.so.6.0libXtst.so.6.1liboldX.so.6.0%llu%s%llu%%%s <%s>%zu %s%-35.35s %c %s %-37.37s %s %s(target-ui) >= 0 && (size_t)(target-ui) == *num/usr/src/usr.sbin/sysinst/arch/evbarm/../../bsddisklabel.cparts->num_part == 0%-15s: %s%-15s: %d%-20s: %s%-20s: %lli%-20s: %d%dM%s: %ulvm pvremove -ffy /dev/r%slvm pvcreate -ffy /dev/r%s /dev/r -l %d -p %d -s %dlvm vgcreate %s %s %s -C %c -M %c -Z %c --minor %d -m %d -R %d -r %d -i %d -I %d -L %lliMlvm lvcreate %s %s %-56s (%s) %-56s %spartmanlvol%.2dvg%.2ddd if=/dev/zero of=%s bs=1m count=% lli progress=100 msgfmt=humanvndconfig %s vnd%d %s %d %d %d %dvndconfig %s vnd%d %s/tmp/raid.%d.confCould not open %s for writing START array %d %d %d START disks START spare START layout %d %d %d %d START queue fifo 100 raidctl -C %s raid%draidctl -I %d raid%draidctl -vi raid%draidctl -v -A yes raid%dpartitining error %s RAIDframe configuring error #%d cgdconfig -g -V %s -i %s -k %s -o /tmp/cgd.%d.conf %s %dcgdconfig -V re-enter cgd%d '%s' /tmp/cgd.%d.confCGD configuring error #%d LVM configuring error #%d VND configuring error #%d %-43.42s %25.24s%s (%s) %svnd%dcgd%d (%s-%d)VG '%s'%lli/%lliPartman device: %s (%s, %s-%d) (lvl %d, %d disks, %d spare)/dev/zeroumount -f /dev/%scgdconfig -u %svndconfig -u %sraidctl -u %sdkctl %s delwedge %seject -t disk /dev/%sddkctl %s makewedges/usr/src/usr.sbin/sysinst/arch/evbarm/../../partman.c/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c%s_%lli@%lliNAME=%sp->gp_flags & GPEF_WEDGEparts != NULLgpt destroy %sparts->disk_size > 0Start:Size:Type:TypeID:GUID:Label:Attributes:gpt -r show -b %llu %s 2>/dev/nullstart == 0have_gptgpt -rq header %sgpt -r show -a %s 2>/dev/nullgpt %s %s -b %llu %s/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1138: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../gpt.c:1100: internal error-p %zugpt create %s %sgpt -n remove -b %llu %sgpt -n resize -b %llu -s %llus %sgpt type -b %llu -T %s %sgpt label -b %llu -l '%s' %sgpt set -N -b %llu %s-l '%s'gpt -n add -b %llu -s %llus -t %s %s %sgpt -n add -b %llu -s %llus %s %ssysvv71kv8otherhpfshfsjfs2minixfs3vmwresv/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2100: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1743: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:1773: internal error/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.cparts->dp.disk_size > 0wedge_dev[0] != 0/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2067: internal errorparts->geo_sec != 0t != 0info->nat_type != NULL/usr/src/usr.sbin/sysinst/arch/evbarm/../../mbr.c:2198: internal errorWindows FAT32, LBAExtended partition, LBAFreeBSD/386BSDNTFS volume setPReP BootDOS FAT16, <32MDOS FAT16, >32MWindows FAT16, LBAWindows FAT32(U)EFI Boot***************************************************************************************************************************************************************************************************************************************usage: %s [-ez] [-b buffersize] [-f file] [-l length] %*.s [-p prefix] cmd [args...] input sizeb:ef:l:p:zgzip -l %sreading compressed file lengthclosing compressed file length pipegzip pipefork for gzipexec()ing gzipmalloc for buffersizefork for output pipecould not exec %swriting %u bytes to output pipecontrol_handle1control_handle_datacontrol_writeonedhcpcd_reportssiddhcpcd_initstate2dhcpcd_getinterfacesconfigure_interface1~!3dhcpcd_daemonisedhcpcd_selectprofiledhcpcd_prestartinterfacesignal_cbdhcpcd_handleinterfacedhcpcd_linkoverflowdhcpcd_handlelinkdhcpcd_handlehwaddrCopyright (c) 2006-2019 Roy Marplesmain duid_geteloop_event_add_rweloop_event_delete_writeeloop_q_timeout_add_tveloop_q_timeout_deleteeloop_exiteloop_requeueeloop_signal_set_cbeloop_signal_maskeloop_startxsocketif_discoversplitvadd_environparse_option?% btc_d6 e1 f6 g1 h1 i5>jYk6 l = m6 n]o6 pGXqr6 s6 tZ2 ukv6 w . x6 zGy6 A6 B 7 Cj/ D7 E2B F7 G%7 H 3 I-J/7 K67 L>\ M?7 NE7 ON7 P[7 QSUTc7 Um7 Vw7 W7 X7 Z,% 17 47 66 | ~7 }7 7 7 7 7 7 7 7 7 7 OE D > > ? :? c? ? ? ? ? @ D@ m@ @ @ @ A ,A SA ~A A A A "B 7B UB gB yB B B B B &C 8C PC dC xC C C C C C C D D ;D C D YD mD D D D D D D E E BE D E TE |E dC PC E E E E E F 0F PF sF F F F yB F G if_copysaif_opensockets_os0NH RH VH if_routeif_initrtif_ifa )( PT@P HEPT$ @DCget_leaseread_leasedhcp_openbpflog_dhcpQ Q Q aQ dhcp_bindQ O Q Q G O R J R dhcp_informdhcp_start1dhcp_initdhcp_handledhcpdhcp_readbpfdhcp_readudpdhcp_recvmsgdhcp_dumpinet_dhcproutesipv4_deladdripv4_getstateipv4_addaddripv4_handleifaipv6_readsecret^^ipv6_deleteaddripv6_addaddr1ipv6_newaddr^ipv6_getstateipv6_addlinklocalcallbackipv6_regentempaddripv6_tempdadcallbackipv6nd_dadcallbackipv6nd_sendrsprobeipv6nd_startrs1ipv6nd_rtprefipv6nd_applyraipv6nd_expireraipv6nd_handledataipv6nd_recvmsgipv6nd_handleraLc Uc `c ic ] ] pc ] b yc b b b c c *c 8c dhcp6_checkstatusokdhcp6_validateleasedhcp6_openudpdhcp6_sendmessagedhcp6_startdiscoverdhcp6_startinformdhcp6_startrenewdhcp6_startrequestdhcp6_startrebinddhcp6_writeleasedhcp6_recvifdhcp6_recvdhcp6_recvmsgdhcp6_start1 '')*PQ'|}wdhcp6_startinitdhcp6_startconfirmdhcp6_startreleasedhcp6_dump/var/run/dhcpcd.unpriv.sock/var/run/dhcpcd%s%s.sock%s: connected to Access Point `%s'%s: IAID conflicts with one assigned to %sEXPIRE6EXPIRE%s: removing interfaceDEPARTEDSTOPPEDNOCARRIERPREINIT%s: waiting for an %s addressexiting due to oneshotforking to background%s: pipe%s: fork%s: pidfile_lock %d%s: write%s: eloop_requeue%s: readforked to background, child pid %d%s: no profile %s%s: selected profile %s%s: confile file changed, expiring leases%s: carrier lost%s: carrier acquired%s: waiting for carrierDUID %s%s: IAID %s%s: IA type %u IAID %s%s: ipv6_start%s: dhcp6_startRECONFIGUREstoppingSIGINTreceived %s, %sSIGTERMreleasingSIGALRMSIGHUPrenewingSIGUSR1reopening logSIGUSR2received SIGPIPEreceived signal %d but don't know what to do with it%s: interface departed%s: interface updated%s: interface addedroute socket overflowed - learning interface state%s: if_opensockets%s: new hardware address: %s--version8.1.9--getconfigfile--getinterfaces--listencontrol command: %s:146bc:de:f:gh:i:j:kl:m:no:pqr:s:t:u:v:wxy:z:ABC:DEF:GHI:JKLMNO:PQ:S:TUVW:X:Z:[master] [ip4] [ip6]--helpusage: dhcpcd [-146ABbDdEGgHJKLMNPpqTV] [-C, --nohook hook] [-c, --script script] [-e, --env value] [-F, --fqdn FQDN] [-f, --config file] [-h, --hostname hostname] [-I, --clientid clientid] [-i, --vendorclassid vendorclassid] [-j, --logfile logfile] [-l, --leasetime seconds] [-m, --metric metric] [-O, --nooption option] [-o, --option option] [-Q, --require option] [-r, --request address] [-S, --static value] [-s, --inform address[/cidr[/broadcast_address]]] [--inform6] [-t, --timeout seconds] [-u, --userclass class] [-v, --vendor code, value] [-W, --whitelist address[/cidr]] [-w] [--waitip [4 | 6]] [-y, --reboot seconds] [-X, --blacklist address[/cidr]] [-Z, --denyinterfaces pattern] [-z, --allowinterfaces pattern] [--inactive] [interface] [...] dhcpcd -n, --rebind [interface] dhcpcd -k, --release [interface] dhcpcd -U, --dumplease interface dhcpcd --version dhcpcd -x, --exit [interface]dhcpcd 8.1.9 %s Compiled in features: INET INET6 DHCPv6/etc/dhcpcd.confInterface options: DHCPv4 options: ND options: DHCPv6 options:/var/run/dhcpcd%s%s%s.pid%s: chdir `/'%s: eloop_init%s: eloop_signal_set_cb%s: eloop_signal_mask%s: if_discoversending commands to master dhcpcd processsend OK%s: control_send%s: control_opensending signal %s to pid %ddhcpcd not runningwaiting for pid %d to exitpid %d failed to exit/var/run%s: mkdir `%s'/var/db/dhcpcd%s: pidfile_lockdhcpcd already running on pid %d (%s)%s: control_startdhcpcd-8.1.9 starting%s: interface not found or invalidno valid interfaces foundaborting as link detection is disabledno interfaces have a carrier%s: eloop_start%s: control_stopdhcpcd exited/var/db/dhcpcd/duidDUID too big (max %u): %smachdep.dmi.system-uuid00000000-0000-0000-0000-000000000000%s: does not have hardware addresspicked interface %s to generate a DUIDno interfaces have a fixed hardware addresseloop != NULL/usr/src/external/bsd/dhcpcd/dist/src/eloop.cread_cb != NULL || write_cb != NULLwhen != NULLcallback != NULL%s: SO_RERROR%s: is a Virtual Interface Master, skipping%s: ignoring due to interface type and no config%s: unsupported interface type 0x%.2x%s: if_init%s: no assignment: %snd_dhcp6_`%s' is not a valid CIDR`%s' is not a valid IP address/libexec/dhcpcd-run-hooks%s: hostnamehostname cannot begin with .vendorclassidfailed to convert leasetime %sfailed to convert metric %sfailed to convert timeout %suserclassinvalid vendor format: %svendor option should be between 1 and 254 inclusivefailed to convert reboot %sskip_hooks=%sptrbothdisableinvalid value `%s' for FQDNclientidstatic assignment requiredip_address=subnet_mask=broadcast_address=ms_classless_static_routes=all routes need a gatewayrouters=interface_mtu=invalid MTU %sip6_address=%s: failed to convert prefix leninvalid AF_INET6: %soption `%s' does not take an IPv4 addressinvalid IAID %s%s: IA_PD not compiled inIA with IAID must belong in an interface blockinvalid IAID: %sembed must be after a define or encapencap must be after a defineinvalid syntax: %sinvalid code: %sinvalid syntaxfailed to convert lengthincomplete request typeoptionalincomplete optional typeincomplete index typeincomplete array typeunknown type: %signoring length for type `%s'ignoring array for stringsmissing bitflag assignmenttype %s requires a variable namevendor class is too bigno authentication supportcontrolgroup: %s: not foundmudurloption %d requires an argumentunknown option: %s%s: fopen `%s'arpingenvreconfigureleasetimerebindpersistentinforminform6waitipallowinterfacesnoarpnobackgroundnohooklastleasenogatewayxidhwaddrnolinknoipv4llrenewnooptionprintpidfilerequiredumpleasevariableswhitelistblacklistdenyinterfacesipv4onlyipv6onlyfallbacknoipv6rsipv6ra_autoconfipv6ra_noautoconfipv6ra_forknoipv4noipv6noaliasia_pdhostname_shortdefinenddefine6vendoptvendclassauthprotocolauthtokennoauthrequirednodhcpnodhcp6controlgroupslaacbootpnodelaynouplastleaseextendinactivelink_rcvbufrt1->rt_ifp != NULL/usr/src/external/bsd/dhcpcd/dist/src/route.crt2->rt_ifp != NULL(null) reject%s: %s host route to %s%s: %s host route to %s via %s%s: %s default route%s: %s default route via %s%s: %s%s route to %s/%d%s: %s%s route to %s/%d via %s&ctx->froutes != rtsrt->rt_ifp != NULLaddingchangingnrt != NULLif_route (CHG)if_route (DEL)if_route (ADD)rt->rt_ifp->ctx != NULLpid %d deleteddeletingsa != NULL/usr/src/external/bsd/dhcpcd/dist/src/sa.cbuf != NULLlen > 0sa1 != NULLsa2 != NULLsa_cmp(sa, &ss.sa) == 0sa_toprefix(sa) == prefixaddr != NULL - %s %s_%s/usr/bin:/usr/sbin:/bin:/sbinTESTSTATIC6ROUTERADVERTUNKNOWNPATH=%sinterface=%sreason=%spid=%difcarrier=%sifmetric=%difwireless=%difflags=%uifmtu=%dinterface_order=if_up=falseif_down=%sif_down=falseif_up=trueif_down=trueprotocol=%sif_afwaiting=%daf_waiting=%dsyslog_debug=trueprofile=%sifssid=%s*(bufp + 1) != '\0'/usr/src/external/bsd/dhcpcd/dist/src/script.c*(bufp - 1) == '\0'%s: executing `%s' %s%s: %s: WEXITSTATUS %d%s: %s: %s%s: control_queuestatic6reasonifcarrierifmetricifwirelessinterface_orderlocalhost. embed uint8 int8 uint16 int16 uint32 int32 ipaddress ip6address bitflags dname ascii raw binhex rfc3361 rfc3442 norequest%s-%s%s-%s:%s-%s:%snd6_/var/db/dhcpcd/%s%s.lease/var/db/dhcpcd/%s%s.lease6%s: %s %d%s_%s%d%s: %s %d.%d/%zu: malformed embedded option%s: %s %d.%d/%zu: missing embedded option%s: %s %d.%d/%zudefine 1 request ipaddress subnet_maskdefine 121 rfc3442 classless_static_routesdefine 249 rfc3442 ms_classless_static_routesdefine 33 request array ipaddress static_routesdefine 3 request array ipaddress routersdefine 6 array ipaddress domain_name_serversdefine 12 dname host_namedefine 15 array dname domain_namedefine 26 uint16 interface_mtudefine 28 request ipaddress broadcast_addressdefine 50 ipaddress dhcp_requested_addressdefine 51 request uint32 dhcp_lease_timedefine 52 byte dhcp_option_overloaddefine 53 byte dhcp_message_typedefine 54 ipaddress dhcp_server_identifierdefine 55 array byte dhcp_parameter_request_listdefine 56 string dhcp_messagedefine 57 uint16 dhcp_max_message_sizedefine 58 request uint32 dhcp_renewal_timedefine 59 request uint32 dhcp_rebinding_timedefine 60 string vendor_class_identifierdefine 61 binhex dhcp_client_identifierdefine 80 norequest flag rapid_commitdefine 81 embed fqdnembed bitflags=0000NEOS flagsembed byte rcode1embed byte rcode2embed optional domain fqdndefine 119 array domain domain_searchdefinend 1 binhex source_addressdefinend 2 binhex target_addressdefinend 3 index embed prefix_informationembed byte lengthembed bitflags=LA flagsembed uint32 vltimeembed uint32 pltimeembed uint32 reservedembed array ip6address prefixdefinend 5 embed mtuembed uint16 reservedembed uint32 mtudefinend 25 index embed rdnssembed uint32 lifetimeembed array ip6address serversdefinend 31 index embed dnsslembed domain searchdefine6 1 binhex client_iddefine6 2 binhex server_iddefine6 3 norequest index embed ia_naembed binhex:4 iaidembed uint32 t1embed uint32 t2encap 5 optionencap 13 optiondefine6 4 norequest index embed ia_taembed uint32 iaiddefine6 5 norequest index embed ia_addrembed ip6address ia_addrdefine6 12 ip6address unicastdefine6 13 norequest embed status_codeembed uint16 status_codeembed optional string messagedefine6 18 binhex interface_iddefine6 19 byte reconfigure_msgdefine6 20 flag reconfigure_acceptdefine6 23 array ip6address name_serversdefine6 24 array domain domain_searchdefine6 39 embed fqdnembed bitflags=00000NOS flagsdefine6 82 request uint32 sol_max_rtdefine6 83 request uint32 inf_max_rtsrc != NULL/usr/src/external/bsd/dhcpcd/dist/src/if-bsd.c%s: SO_USELOOPBACK%s: SIOCGIFALIAS%s: if_addrflags6net.inet6.ip6.use_tempaddrnet.inet6.ip6.temppltimenet.inet6.ip6.tempvltime%s: SIOCGIFINFO_FLAGS%s: SIOCSIFINFO_FLAGSSIOCSRTRFLUSH_IN6SIOCSPFXFLUSH_IN6fwetapxvif/dev/bpfBPF version mismatch - recompileBerkley Packet Filter%s: duplicate xid on %sbootp != NULL/usr/src/external/bsd/dhcpcd/dist/src/dhcp.cia != NULL%s: open `%s'reading standard input%s: reading lease `%s'%s: %s: truncated lease%s not foundNAK:%s: %s %s %s `%s'%s: %s %s %s %s `%s'%s: %s %s %s%s: %s %s %s %s %s %03d %sMS %s: using %sClassless Static Routes%s_ip_address=%s%s_subnet_cidr=%d%s_subnet_mask=%s%s_network_number=%s%s_broadcast_address=%s%s_filename=%s%s_server_name=%s%s: using static address %s/%dSTATIC%s: received approval for %sINFORMTIMEOUT%s: leased %s for infinity%s: minimum lease is %d seconds%s: rebind time greater than lease time, forcing to %u seconds%s: renewal time greater than rebind time, forcing to %u seconds%s: leased %s for %u secondsREBINDREBOOTBOUND%s: renew in %u seconds, rebind in %u seconds%s: writing lease `%s'%s: releasing lease of %sBOOTP%s: sending %s with xid 0x%x%s: sending %s (xid 0x%x), next in %0.1f seconds%s: if_getmtu%s: if_setmtuDuplicate address detected%s: VIVCO option too big%s: DHCP message too big%s: dhcp_sendudp%s: dhcp_makeudppacket%s: bpf_sendFAIL%s: soliciting a DHCP lease (requesting %s)%s: soliciting a %s lease%s: timed out contacting a DHCP server, using last lease%s: renewing lease of %s%s: failed to renew DHCP, rebinding%s: expire in %u seconds%s: waiting for 3rd party to configure IP address3RDPARTY%s: cannot add IP address in test mode%s: DAD detected %s%s: waiting for DAD on %s%s: dhcp_open%s: using ClientID %s%s: using hwaddr %s%s: dhcp_init%s: discarding expired lease%s: informing address of %s%s: rebinding lease of %s%s: ignoring DHCP reply (expecting BOOTP)discarding Force Renewunauthenticated Force Renewbound, ignoringprobing, ignoringreject DHCPreject NAK%s: message: %sno address givenreject invalid addressdeclined duplicate addressofferedignoring offer ofnot ACK or OFFERignoring ack ofacknowledged%s: non whitelisted DHCP packet from %s%s: blacklisted DHCP packet from %s%s: truncated packet (%zu) from %s%s: %s: short frame header%s: checksum failure from %s%s: received BOOTP for inactive interface%s: redirecting DHCP message to %s%s: DHCP lease expired, extending lease%s: DHCP lease expiredDUMP%s: delaying IPv4 for %0.1f seconds%s: pid %d deleted IP address %s%s: DAD completed for %sip_addresssubnet_cidrnetwork_numberserver_nameDISCOVERREQUESTDECLINERELEASEFORCERENEWstate->addr/usr/src/external/bsd/dhcpcd/dist/src/ipv4.c%s: forcing router %s through interface%s: router %s requires a host route%s: deleting IP address %s%s: adding IP address %s %s %s%s: if_addaddress%s: IP address %s already exists%s: added address vanished/var/db/dhcpcd/secret%s: IPv6 static DAD completedcannot find a loopback interface to reject via%s: deleting address %stemporary %s: %s: lifetime overflow%s: adding %saddress %s%s: pltime infinity, vltime infinity%s: pltime infinity, vltime %u seconds%s: pltime %useconds, vltime infinity%s: pltime %u seconds, vltime %u seconds%s_ip6_address=%s%s: pid %d deleted address %s%s: waiting for %s to complete%s: regen temp addr %s%s: too many duplicate temporary addresses%s: waiting for Router Advertisement DAD to complete%s: unable to obtain a stable private addressipv6_makestableprivate%s: Router Advertisement DAD completed%s: delaying Router Solicitation for LL address%s: sending Router Solicitation%s: no IPv6 Routers available%s: soliciting an IPv6 router%s: impossible RA flag %x%s: %s: router expired%s: expired address %s%s: part of a Router Advertisement expiredIPv6 ICMP packet too short from %sIPv6 RA packet too short from %sinvalid hoplimit(%d) in RA from %sRA from non local address %s%s: ignoring RA from ourself %s%s: Router Advertisement from %s%s: %s: no longer a default router%s: short option%s: zero length option%s: option length exceeds message%s: reject RA (option %s) from %s%s: reject RA (option %d) from %s%s: invalid option len for prefix%s: invalid prefix len%s: invalid prefix in RA%s: pltime > vltimeipv6_createtempaddr%s: short MTU option%s: invalid MTU %d%s: advertised MTU %d is greater than link MTU %d%s: short RDNSS option%s: reject RA (no option %s) from %s%s: no global addresses for default routedhcp6_start: %s%s: No DHCPv6 instruction in RAinvalid IPv6 type %d or code %d from %snd%zu%s_from=%s%s_acquired=%lld%s_now=%lld%s_addr%zu=%s%s: delaying IPv6 router solicitation for %0.1f secondsreachable againunreachable%s: %s is %s%s: DHCPv6 Vendor Class too big%s: status truncatedUnknown Status (%d)%s: DHCPv6 REPLY: %s%s: option overflow%s: IA option truncated%s: ignoring unrequested IAID %s%s: IAID %s T1(%d) > T2(%d) from %s%s: IA Address option truncated%s: IA Address pltime %u > vltime %u%s: %s: DHCPv6 REPLY missing IA Address%s: DHCPv6 lease truncated%s: no useable IA found in leasestate->new != NULL && state->new_len != 0/usr/src/external/bsd/dhcpcd/dist/src/dhcp6.c%s: ignoring unicast option as not masterdelayingunicastingbroadcasting%s: %s %s (xid 0x%02x%02x%02x), next in %0.1f secondstimespec_to_double(&state->RT) != 0%s: no socket to send from%s: %s: sendmsg%s: sent %d times with no reply%s: soliciting a DHCPv6 lease%s: requesting DHCPv6 information%s: failed to renew DHCPv6, rebinding%s: rebinding prior DHCPv6 lease%s: DHCPv6 DAD completed%s: %s received from %sTIMEOUT6INFORM6BOUND6RENEW6REBIND6REBOOT6%s: %s will expire before renewal%s: ignoring T1 %u due to address expiryUNKNOWN6%s: %s: became stale%s: %s: no valid lifetime%s: refresh in %u seconds%s: leased for infinity%s: renew in %u, rebind in %u, expire in %u seconds%s: will expire%s: waiting for DHCPv6 DAD to complete%s: DHCPv6 reply received but not running%s: DHCPv6 reply received but already bound%s: no DHCPv6 server ID from %s%s: reject DHCPv6 (no option %s) from %s%s: reject DHCPv6 (option %s) from %s%s: SOL_MAX_RT %llu -> %u%s: invalid SOL_MAX_RT %u%s: INF_MAX_RT %llu -> %u%s: invalid INF_MAX_RT %u%s: unauthenticated %s from %s%s: invalid DHCP6 type %s (%d)%s: invalid state for DHCP6 type %s (%d)%s: ADV (no address) from %s%s: ADV %s from %sDHCPv6 packet too short from %s%s: incorrect client ID from %s%s: RECONFIGURE6 recv from %s, sending to all interfaces%s: wrong xid 0x%02x%02x%02x (expecting 0x%02x%02x%02x) from %s%s: redirecting DHCP6 message to %s%s: confirming prior DHCPv6 lease%s: extending DHCPv6 lease%s: no advertising IPv6 router wants DHCP%s: failed to request information%s: DHCPv6 lease expired%s: failed to request address%s: failed to confirm prior address%05d %s%s: delaying DHCPv6 for LL addressSTOP6RELEASE6%s_dhcp6DUMP6SuccessUnspecified FailureNo Addresses AvailableNo BindingNot On LinkUse MulticastNo Prefix AvailableSOLICIT6ADVERTISE6REQUEST6REPLY6CONFIRM6RECONFIGURE6VUJqgf]VUN%IED@=<85430.,*(c'%$P##" ! BrBbFCV{SJ\Bt * u*t *t * +t ,+t L+l+t ++t +t +BBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~t &t di lq t dm tq t  ut t t t t @t t T!P!L!/etc/group/etc/master.passwdJPUPuZ ___ Begin malloc statistics ___ Assertions Boolean MALLOC_OPTIONS: CPUs: Max arenas: Pointer size: Quantum size: Max small size: Chunk size: (2^--- End malloc statistics --- : (malloc) Error in munmap(): : (malloc) Error initializing arena /etc/malloc.confMALLOC_OPTIONS: (malloc) Unsupported character in malloc options: ': (malloc) Error in malloc(): out of memory : (malloc) Error in posix_memalign(): invalid alignment : (malloc) Error in posix_memalign(): out of memory : (malloc) Error in calloc(): out of memory : (malloc) Error in realloc(): out of memory alnumblankcntrlgraphpunctxdigit%s%s%s 646towlowertowupperUnknown error numberUnknown signal numberYP FAKE error %d %ju%ju%s%0*juuappnd,uchgnodumpopaquesappndarchschgsnaparchiveddumpsappendschangesimmutableuappenduchangeuimmutable ,pqrstuwxyzPQRST0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ/dev/ptmtty/dev/XtyXX/var/run/%s%s.pid !#$*0- ).+(/, '!% #34 :./, .   :       , /.       .  .  .=                               9%'A)*& , ./(&-0;51234<=>?C"DEFHGB$21678 !"#6$@8&&&&&&&&&&&"""""""""""$$$$$$$$$2222221222111\+GU9U   +: januarygmtmidnightyeartomorrowa.m.pmp.m.dstmnnoonmiddayiqvwzututcwetbstwatnftnstndtastadtedtcstcdtmstmdtpstpdtystydthsthdtcatahstidlwcetmetmewtmestswtsstfwtfsteetbtzp4zp5zp6ictwastawstwadtawdtcctsgthktjstcastacstcadtacdteastaesteadtaedtgstnztnzstnzdtidleyesterdaytodaynowlastthisnextfirsttwothirdthreefourthfourfifthfivesixthsixseventhseveneightheightninthninetenthteneleventheleventwelfthtwelveagomonthfortnightweekhourminuteminsecondsecfebruarymarchaprilmayjunejulyaugustseptemberseptoctobernovemberdecembersundaysumondaymotuesdaytuestuwednesdaywedneswedswethursdaythursthurfridayfrsaturdaysafull-duplexfdxhalf-duplexhdxflowcontrolflag0flag1flag2loopbackhw-loopbackloopmasterrxpausetxpauseEarlyTokenReleaseETRSourceRoutingSRCRTAllRoutesALLRdual-attachdasadhochostapmonitorturboibsswdsmeshautoselectautomanualnone10baseT10baseT/UTP10UTP10BASE-T10base210base2/BNC10BNC10BASE210base510base5/AUI10AUI10BASE5100baseTX100TX100BASE-TX100baseFX100FX100BASE-FX100baseT4100T4100BASE-T4100baseVG100VG100VG-AnyLAN100baseT2100T2100BASE-T21000baseSX1000SX1000BASE-SX10baseSTPSTP10STP10BASE-STP10baseFLFL10FL10BASE-FL1000baseLX1000LX1000BASE-LX1000baseCX1000CX1000BASE-CX1000BASE-BX101000BASE-KX1000baseKX1000baseT1000T1000BASE-THomePNA1HPNA12500BASE-KX2500baseKX2.5GBASE-T2500baseT5GBASE-T5GbaseTOther10GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10Gbase-LRM10Gbase-Twinax10Gbase-Twinax-Long10Gbase-T10GbaseCX410GCX410GBASE-CX42500baseSX2500SX1000BASE-SGMII5GBASE-KR10GBASE-AOC10GBASE-CR110GBASE-ER10GBASE-KR10GBASE-KX410GBASE-LX410GBASE-SFI10GBASE-ZR20GBASE-KR225GBASE-ACC25GBASE-AOC25G-AUI25GBASE-CR25GBASE-CR-S25GBASE-ER25GBASE-KR25GBASE-KR-S25GBASE-LR25GBASE-SR25GBASE-T40GBASE-AOC40GBASE-CR440GBASE-ER440GBASE-FR40GBASE-KR440GBASE-LR440GBASE-SR440GBASE-T40G-XLPPI50GAUI-150GAUI-250GBASE-CR50GBASE-CR250GBASE-FR50GBASE-KR50GBASE-KR250GLAUI-250GBASE-LR50GBASE-SR50GBASE-SR256GBASE-R4100GBASE-ACC100GBASE-AOC100GBASE-CR2100GBASE-CR4100GBASE-CR10100GBASE-DR100GBASE-ER4100GBASE-FR100GBASE-KP4100GBASE-KR2100GBASE-KR4100GBASE-LR100GBASE-LR4100GBASE-SR2100GBASE-SR4100GBASE-SR10200GBASE-CR2200GBASE-CR4200GBASE-DR4200GBASE-ER4200GBASE-FR4200GBASE-KR2200GBASE-KR4200GBASE-LR4200GBASE-SR4400GBASE-CR4400GBASE-DR4400GBASE-ER8400GBASE-FR4400GBASE-FR8400GBASE-KR4400GBASE-LR4400GBASE-LR8400GBASE-SR4.2400GBASE-SR8400GBASE-SR16DB9/4Mbit4STPDB9/16Mbit16STPUTP/4Mbit4UTPUTP/16Mbit16UTPSingle-modeSMFMulti-modeMMFCDDI10baseT-FDX10BASE-T-FDX100baseTX-FDX100BASE-TX-FDX1000baseT-FDXFH1FH2DS1DS2DS5DS11DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72DS/354KbpsDS/512KbpsOFDM/3MbpsOFDM/4.5MbpsOFDM/27MbpsHTVHTEthernetetherTokenRingtokenFDDIIEEE802.11CARP11a11b11gfh11na11ng11ac-o %s: option not supportedMissing %s argumentInvalid %s argument `%s'ROOT./dev/sysctl kern.root_device failedNAME=malloc failedsysctl hw.disknames faileddk%s: getwedgeinfo/rdk/rno match for `%s'kern.labelusesmbrCannot copy string; %zu chars needed %zu providedCannot append to string; %zu chars needed %zu providedCannot copy stringCannot allocate %zu bytesCannot allocate %zu blocks of size %zuCannot re-allocate %zu bytesCannot re-allocate %zu * %zu bytesCannot open `%s'Cannot format stringCannot convert string value '%s' with base %d to a number in range [%jd .. %jd]Cannot convert string value '%s' with base %d to a number in range [%ju .. %ju]unusedswapv6v7sysvv71kv8ffsmsdoslfsotherhpfscd9660bootadoshfsfilecoreext2fsntfsraidframeccdjfs2appleufsvinumudfsysvbfsefsnilfscgdminixfs3vmkcorevmfsvmwresv0%llo%lld0x%llx%s%s%s%c/dev/zvol/%sdsk/dev/zvol/%.*s/%s%sTERMUTF-8Inkey wstate screwed - exiting!!!xdumbESCDELAYTABSIZE sklmnopqrZ{tuvwxy  z|}~j|bcdefghWi !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGx\z^y]~_`     IV}a{MJOP[KHLRSQN TU Inkey: Cannot allocate new keymapCould not malloc for key entry inkey: Cannot allocate new key entry chunkInkey state screwed - exiting!!!unknown5MS7)   #$      r?7QQj%^."Ar O.Eg ._l}J2 7Wem<B.>20<sg+ Q |q;o/|>Wa3V9Vi+h[u8e"m:Mk:k+t gZwX(h2)\A_4|v@dpS\n'Px8K{k1Z VTr];f|Q}[ kv/tmF/ B6zF7*:eP:@[\/q Gk%#e$_puHv?5<>dEA|~M;"i7h9[9Y Z=Kg =M)]\bsl*EX [CBph9`%Xb n%p0%{10}%/%{16}%*%p0%{10}%m%+%p0%p0%{2}%*%-%p0%p0%?%>%t%+%;bwamutccxsYAYFYBxtxn eo gn hc HC kmYChshlinYGdadbmimsnxxbNPNDNRos5iYDYE es!hz"ul#xo$YoYpYaBTcoYcYbitlhlw li lm ma sg CoYdYepaMWYfYgNCNlYhYiYjYkYlpbYmvtYnws acS8btblYvZzXycrZAZB ZC ZD cs rP ZyctMCclcbcecdciYwchCCcmdohovileCMve nd!ll"up#vs$Yx%ZE&dc'dl(dv)DI*ds+DK,S1-hd.eA/Yy0as1SA2mb3md4ti5dm6mh7ZF8ZG9Xh:im;ZH<Xl=ZI>Xo?ZJ@ZKAZLBS2CmpDmrEXrFS4GmkHZMIsoJZNKZOLXtMusNZPOXvPSXQecRaeSRATmeUteVedWZQXeiYZRZZS[ZT\S3]S5^ZU_se`ZVaZWbuecZXdRXePAffhgvbhffifsjGmkWGlHUmi1ni2oi3pisoifqiPrIcsIpticualvipwK1xK3yK2zkb{kB}K4~K5kakCktkDkLkdkMkEkSk0k1k2k3k4k5k6k7k8k9k;F1F2F3F4F5F6F7F8F9FAFBFCFDFEFFFGFHFIFJFKFLFMFNFOFPFQFRFSFTFUFVFWFXFYFZFaFbFcFdFeFfFgFhFiFjFkFlFmFnFoFpFqFr%1khkIkAklkH%2%3Km%4%5kN%6%7kP%8%9%0&1&2&3&4&5kr&6&9&0*1*2*3*4*5*6*7*8*9kF*0#1#2#3#4%a%b%c%d%e%fkR%g%h%i%j!1!2kT !3 &7 &8 ku keksl0l1l2l3l4l5l6l7l8l9laLfLFLOmommZY ZZ!Za"Zb#Zc$Zd%Mi&nw'Ze(oc)op*pc+DC,DL-DO.Zf/IC0SF1AL2LE3Zg4RI5Zh6SR7UP8Zi9S6:pk;pl<xl=px>pn?ps@pOApfBpoCPUDQDERCFrpGRFHRQIr1Jr2Kr3LrfMrcNcvOscPS7QsfRsrSZjTs0Us1Vs2Ws3XsAYABZAF[sa\Sb]Zk^Zl_SC`YzgsLhspbSfcMLdZmeYZgYIhMRiZnjstkMTlZomZpnwioZqpZrqZsrZtsZutZvutavZwwtsxTOyu0zu1{u2|u3}u4~u5u6u7u8u9uchuWAXFXNZx@0@1|@2@3@4@5@6@7@8@9beltc^Gcr^Mcud1^Jht^Iindkbs^Hkcub1kcud1nel^M^JTERM environment variable not setnot enough memory to create terminal structurecannot access the terminfo database%s: terminal not listed in terminfo databaseunknown error%s: generic terminal%s: hardcopy terminalLINESCOLUMNSansi@P bG [%i%d;%dR[?%[;0123456789]c* Z [4%p1%dm[ [3%p1%dmH\V[0;10%?%p1%t;7%;%?%p2%t;4%;%?%p3%t;7%;%?%p4%t;5%;%?%p6%t;1%;%?%p7%t;8%;%?%p9%t;11%;m34E]`cUCJN?+,-.0`afghjklmno~pqrs_tuvwxyz{|}~S13 [%p1%dD. [%p1%dB5 [%p1%dC8 [%p1%dA, [%p1%dP- [%p1%dMR [%p1%dX [%i%p1%dGv0 [%p1%d@2 [%p1%dL1 [%p1%dS{} BC' G%p1%c[%p2%{1}%-%db7 [%p1%dTU(BV)BW*BX+BO [%i%p1%dd ![%i%p1%d;%p2%dH#'(kHvR AXfbsfdumbP  R vt100 $P @G3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~3 $<2>4 $<2> $<50> [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC!$<2>[%i%p1%d;%p2%dH$<5>8 [%p1%dA#$<2> $<50>$<3> $<3>/(B)0v kHR {ODOBOC OApf1pf2pf3pf4@BCN8E $<2>SM$<5>ST[?7l[?1l>`$<2>c$<2>K>[?3l[?4l[?5l[?7h[?8hP7\L[0%?%p1%p6%|%t;1%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;m%?%p9%t%e%;$<2>U $<2>12[?7h[?1h=J $<2>N $<2>OyOxOtOuOvOlOwOMOPOQOROSxOqyOszOr~OpOn bsfvt220 $P 7_3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRDo[?7h[>[?1l F[?4l{ [3~OP[21~[23~[24~[25~[26~[31~[32~[33~OQ[34~OROS[17~[18~[19~[20~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cJ[?3lP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfwsvt25 $P @g[?25l [?25ho [3~[8~[11~[21~[23~[24~[12~[13~[14~[15~[17~[18~[19~[20~[7~*JcZ [4%p1%dm[ [3%p1%dm3``aaffggjjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34 [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#, [%p1%dP'- [%p1%dM(R [%p1%dX/)0h[?5h$<200/>[?5lv kH0 [%p1%d@q/usr/share/tabset/vt1002 [%p1%dLvRD{ [25~[26~[31~[32~[33~[34~[1~[28~[2~[6~[5~[29~[4~pf1pf2pf3pf4'EN8ESMS(B$<4>T[?7lY`cP7\K[0%?%p6%t;1%;%?%p2%t;4%;%?%p4%t;5%;%?%p1%p3%|%t;7%;m%?%p9%t(0%e(B%;$<2>U(B1(0$<2>2[?7h;JN@BC [%i%d;%dR[?%[;0123456789]c bsfxterm P @61 [%p1%dSzOE}OM7 [%p1%dT [%i%d;%dR[?%[;0123456789]cODOBOC OAOFOHOP[21~[23~[24~[15;2~[17;2~[18;2~OQ[19;2~[20;2~[21;2~[23;2~[24;2~[15;5~OR[17;5~[18;5~[19;5~[20;5~[21;5~[23;5~[24;5~OS[15;6~[17;6~[18;6~[19;6~[20;6~[21;6~[23;6~[24;6~[15~[15;3~[17;3~[18;3~[19;3~[20;3~[21;3~[23;3~[17~[24;3~[18~[19~[20~[3;2~[2;2~[6;2~[5;2~[2~[6~[5~[3~5``aaffggiijjkkllmmnnooppqqrrssttuuvvwwxxyyzz{{||}}~~34[?25l [?12l[?25h [%i%p1%d;%p2%dr3 [%p1%dD. [%p1%dB 5 [%p1%dC![%i%p1%d;%p2%dH8 [%p1%dA#$ [?12;25h, [%p1%dP'7- [%p1%dM(R [%p1%dXh[?5h$<100/>[?5l [%i%p1%dGv kH0 [%p1%d@2 [%p1%dLvR Ho[!p[?3;4l>* N8ESMZS(BT[?7lV [?1049lY[?1l> [?1034l`cJcK[!p[?3;4l>P7Z [4%p1%dm[ [3%p1%dm]F[4%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;mcF[3%?%p1%{1}%=%t4%e%p1%{3}%=%t6%e%p1%{4}%=%t1%e%p1%{6}%=%t3%e%p1%d%;m\]%?%p9%t(0%e(B%;[0%?%p6%t;1%;%?%p5%t;2%;%?%p2%t;4%;%?%p1%p3%|%t;7%;%?%p4%t;5%;%?%p7%t;8%;mU(B<1(02[?7h5 [?1049h;[?1h= [?1034hJNO [%i%p1%dd@BC{+?kDNskDN3skDN4skDN5skDN6skDN7skLFT3skLFT4skLFT5skLFT6skLFT7skRIT3skRIT4skRIT5skRIT6skRIT7skUPskUP3skUP4skUP5skUP6skUP7skDC3s[3;3~kDC4s[3;4~kDC5s[3;5~kDC6s[3;6~kDC7s[3;7~kEND3skEND4skEND5skEND6skEND7skHOM3skHOM4skHOM5skHOM6skHOM7skIC3s[2;3~kIC4s[2;4~kIC5s[2;5~kIC6s[2;6~kIC7s[2;7~kNXT3s[6;3~kNXT4s[6;4~kNXT5s[6;5~kNXT6s[6;6~kNXT7s[6;7~kPRV3s[5;3~kPRV4s[5;4~kPRV5s[5;5~kPRV6s[5;6~kPRV7s[5;7~Crs]112Css ]12;%p1%sMss]52;%p1%s;%p2%sSes[2 qSss [%p1%d qbsfAXfXTfmemlslmemusmE3s%s.cdbTERMINFOTERMCAP$TERMINFO$TERMCAPTERMINFO_DIRSHOME/usr/share/misc/terminfo%s/.terminfoansivt100vt220wsvt25xterm%s: %s: unknown capability%s: %s: cap name is too longno seperator found: %s%s: %s: illegal ^ character%s: %s: unprintable character%s: %s: non octal digit%s: %s: string is too long%s: %s: invalid string%s: %s: not a number%s: %s: number out of range2Kn,X` %Kbwambcecccxhpxhpacpixcrxmxtxenleognhcchtskmdaisyhshlsinlpixdadbmirmsgrnxonxsbnpcndscrnrrmcosmc5ixvpasameslokhzulxon # " "  "$bitwinbitypebufszbtnscolsspinhspinvitlhlwlineslmmaxmccolorsmaddrmjumppairswnummcsmlsncvnlabnpinsorcorlorhiorvipbcpsvtwidcswsl     acscscesacbtbelbicrbinelbirepcrcpilpichrcvrcsrrmpcsnmtbcmgcclearel1eledcsincolornmhpacmdchcwincupcud1homeciviscub1mrcupcnormcuf1llcuu1cvvisdefbidefcdch1dl1devtdialdsldclkdispchdenacsendbismacssmamblinkboldsmcupsmdcdimswidmsdrfqehhlmsmirsitmelhlmslmelohlmsmicmsnlqsnrmqsmpchprotreverhlmsmscinvissshmsmsossubmssupmethlmsmulsumevhlmsmxonechrmacsrmamsgr0rmcuprmdcrwidmrmirritmrlmrmicmrmpchrmscrshmrmsorsubmrsupmrmulrumrmxonpausehookflashfffslgetmwingohupis1is2is3ifiproginitcinitpich1il1ipka1ka3kb2kbskbegkcbtkc1kc3kcanktbckclrkclokcmdkcpykcrtkctabkdch1kdl1kcud1krmirkendkentkelkedkextkf0kf1kf2kf3kf4kf5kf6kf7kf8kf9kf10kf11kf12kf13kf14kf15kf16kf17kf18kf19kf20kf21kf22kf23kf24kf25kf26kf27kf28kf29kf30kf31kf32kf33kf34kf35kf36kf37kf38kf39kf40kf41kf42kf43kf44kf45kf46kf47kf48kf49kf50kf51kf52kf53kf54kf55kf56kf57kf58kf59kf60kf61kf62kf63kfndkhlpkhomekich1kil1kcub1kllkmrkkmsgkmouskmovknxtknpkopnkoptkppkprvkprtkrdokrefkrfrkrplkrstkreskcuf1ksavkBEGkCANkCMDkCPYkCRTkDCkDLksltkENDkEOLkEXTkindkFNDkHLPkHOMkICkLFTkMSGkMOVkNXTkOPTkPRVkPRTkrikRDOkRPLkRITkRESkSAVkSPDkhtskUNDkspdkundkcuu1rmkxsmkxlf0lf1lf2lf3lf4lf5lf6lf7lf8lf9lf10flnrmlnsmlnrmmsmmmhpamcud1mcub1mcuf1mvpamcuu1minfonelporderocoppaddchdlcudmcudichindnilcubmcubcufmcufrincuumcuupctrmpfkeypflocpfxlpfxplnmc0mc5pmc4mc5pulseqdialrmclkreprfireqmprs1rs2rs3rfrcvpascscescindriscss0dss1dss2dss3dssgr1setabsetafsgrsetbsmgbsmgbpsclksetcolorscpsetfsmglsmglpsmglrslinesslengthsmgrsmgrphtssmgtbsmgtsmgtpwindsbimscsdrbimrcsdsubcssupcshtdocrtsltoneu0u1u2u3u4u5u6u7u8u9uchuwaitxoffcxonczerom<#E1j`r8'g |SVXX}!QX>cG4*rXvUljR2Cl,Ushx 4"sW)hmkcKu=z>;' Dh=*wHUYsf4/~>:%#K3}*t-yda,0?uZv Dnd>c++1tDyALAa dNn2K)kceUiE408 *J!k!"QY$ 9JD'oN ,K FWWx6e@oF[MA}byr6YK }.5\q6 qZ5L8nAFYJ _c dv32:]x['~|i acosacosfasinasinfatan2atan2fhypothypotfcoshcoshfexpexpfy0y0fy1y1fynynflgammalgammafloglogflog10log10fpowpowfsinhsinhfremainderremainderfacoshacoshfatanhatanhfscalbscalbfj0j0fj1j1fjnjnfgammagammaflog2log2facos: DOMAIN error asin: DOMAIN error atan2: DOMAIN error y0: DOMAIN error y1: DOMAIN error yn: DOMAIN error lgamma: SING error log: SING error log: DOMAIN error log10: SING error log10: DOMAIN error pow(0,0): DOMAIN error pow(0,neg): DOMAIN error neg**non-integral: DOMAIN error sqrtsqrtfsqrtlsqrt: DOMAIN error fmodfmodffmodlfmod: DOMAIN error remainder: DOMAIN error acosh: DOMAIN error atanh: DOMAIN error atanh: SING error : TLOSS error gamma: SING error log2: SING error log2: DOMAIN error 0C0`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length check@@ !1Aa  0@` #+3;CScs inflate 1.2.10 Copyright 1995-2017 Mark Adler deflate 1.2.10 Copyright 1995-2017 Jean-loup Gailly and Mark Adler 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfa1.2.10need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version   (08@P`p    0@`  0@`           L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cprop_string_append_cstringsrc != ((void *)0)/usr/src/common/lib/libprop/prop_string.c_prop_object_externalize_append_char _prop_object_internalize_find_tagprop_object_retainprop_object_releaseprop_object_release_emergencyprop_object_equals_with_errorctx->poec_capacity != 0/usr/src/common/lib/libprop/prop_object.cctx->poec_buf != ((void *)0)ctx->poec_len <= ctx->poec_capacity<>&plist version="1.0"plist!((*cp) == '\0')array?xml !DOCTYPE plist